(data stored in ACNUC7421 zone)

EMBL: CP000859.PE349

CP000859.PE349       Location/Qualifiers
FT   CDS_pept        complement(400007..401977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0349"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   protein of unknown function DUF1365; Methyltransferase type
FT                   11; Methyltransferase type 12; KEGG: mmw:Mmwyl1_4070
FT                   cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66159"
FT                   /db_xref="GOA:A8ZSZ5"
FT                   /db_xref="InterPro:IPR010775"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSZ5"
FT                   /protein_id="ABW66159.1"
FT                   /translation="MNSKIFCVDLYHRRYEPVAHEFHYPLYIYVIDLEELAALDREVPL
FT                   FGYNRKALVSIHDRDYLSDAAGTIKDKLFRLLEQEGLRETVHTVYLVTAARYAGYVFNP
FT                   VSFYYCLGADDAVACIVAEVNNTFGERHIYVLKDHLPAPEGWAASFRTTKRFHVSPFFP
FT                   RQGEYEFFFSPIGETMDIRINYYREGRPQLKTRLKGHCLPLTRRTLAMTVVRRPIQAVM
FT                   SIPRIFYQAIILHYKKGLPINSKPAPMDPRTMEKAPSPVLQRIYRSAVGGVLSTLRQGS
FT                   LTLVLPDGRRQVHGRLGKQQEGVIEVHHHAFFKKLFFSADIGLGEAYMAGDWSSPDLAG
FT                   AIKVLACNIEALDQRTSVLPAFTRIIDFARHRRRANTVPGARQNIGAHYDTSNAFFSLV
FT                   LDPTMTYSCGLFERPTDDLHQSQLNKIARICEKAGIQATDHVLEIGTGWGGFAVEAVRQ
FT                   TGCALTTTTISQEQHDYVTRMVSRLEMEDRIEVLQQDYRHLRGRFDKIVSIEMLEAVGH
FT                   EYYRDYFSICASLLKPGGRMVVQVITIPHKRYHAYRRRADWIQKYIFPGGMLPSREILE
FT                   ETINRWTSLQVAEVTALGSHYVPTLAAWRNNLLARRAQIEKLGFDDRAFRMWEYYFASC
FT                   EAGFSAGIIDNIHMVLEKPAP"
     atgaactcaa aaatcttttg cgtagacctt taccacaggc gctacgaacc ggttgcccat        60
     gagttccact atccgcttta catctatgtg atcgatcttg aagagctggc cgccctggac       120
     cgggaggtgc cgcttttcgg atacaaccgg aaagcgctgg tatcgatcca cgacagggac       180
     tacctttccg acgcggcggg caccatcaaa gacaagctct ttcggctgct tgaacaggag       240
     gggctgcgcg aaacggttca caccgtttac ctggtcaccg cggcccggta tgccggttat       300
     gttttcaacc cggtgagctt ttattactgc ctgggggcgg acgacgctgt tgcctgcatc       360
     gtggcggaag tgaacaacac ctttggcgag cgccatatct atgtgctcaa ggaccacctc       420
     cccgcccctg agggctgggc ggcgtccttt cggaccacca agcggtttca tgtttctcct       480
     tttttcccgc ggcaggggga atatgagttt ttcttttccc ccatcggcga aacaatggat       540
     atccgcatca attattaccg ggagggccgg ccccagctga aaacccggct gaaggggcac       600
     tgcctgccgc tgacccgccg gaccctggcc atgacagtgg tccgccgtcc gatccaggcg       660
     gtcatgtcca ttccccgcat tttctatcag gcgatcattc ttcattacaa aaaagggctc       720
     cccattaaca gcaagccggc gcccatggac ccgcgaacca tggaaaaagc cccgtcgccc       780
     gttcttcaga gaatataccg gtcagcggtg gggggcgtgt tgtccacgct gcggcagggc       840
     agcctcaccc tggtgctgcc ggacggccgc cggcaggttc atggccggct cggaaaacag       900
     caggaaggcg tcattgaagt acaccatcac gcgtttttta aaaagttgtt tttcagtgcc       960
     gacattggcc tgggcgaagc ctacatggcc ggggactggt caagcccgga cctggccggc      1020
     gccataaaag tcctggcctg caacatcgag gccctggacc agcggaccag cgtcctgccc      1080
     gcttttacca ggatcatcga ctttgcccgg caccgccggc gggccaacac ggtgcccggt      1140
     gcccggcaaa acatcggggc ccactatgac accagcaacg cgtttttcag cctggtcctg      1200
     gaccctacga tgacctattc ctgcggccta tttgaacgcc cgacagatga tctgcatcag      1260
     tcccagctga acaaaattgc gcgtatctgt gaaaaagccg gcattcaggc caccgaccac      1320
     gtgctggaga tcggcacggg gtggggcggt tttgccgttg aggcggtgcg gcaaaccggg      1380
     tgcgccctca ccaccaccac tatctcccag gaacagcatg actatgtgac acgaatggtt      1440
     tcccggctgg aaatggaaga ccgcattgag gtgctgcagc aggactatcg gcacctgcgg      1500
     ggccgctttg acaaaattgt ttccattgag atgctggagg cggtgggcca cgaatattac      1560
     agggactatt tttccatctg cgcgtccctg ctgaaacccg gtggccgaat ggtggttcag      1620
     gtgatcacca ttccccataa gcgttaccat gcctatcgcc ggcgggcgga ctggatacag      1680
     aagtacattt tccccggcgg catgctgcct tcccgggaaa ttctggaaga gaccatcaat      1740
     cgctggacat ccctgcaggt ggccgaagtg acggccctcg gctcccatta cgtgcccacg      1800
     ctggccgcgt ggcggaacaa cctgctggcc cggcgggcgc aaatcgaaaa gctggggttt      1860
     gacgaccggg cgtttcgcat gtgggagtac tattttgcct cctgtgaggc cgggttttca      1920
     gccggtatta ttgacaatat acatatggtt ctggaaaaac cggccccata a               1971
//

If you have problems or comments...

PBIL Back to PBIL home page