(data stored in ACNUC7421 zone)

EMBL: CP000859.PE35

CP000859.PE35        Location/Qualifiers
FT   CDS_pept        41182..42708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0035"
FT                   /product="SpoIID/LytB domain"
FT                   /note="TIGRFAM: SpoIID/LytB domain; PFAM: Tetratricopeptide
FT                   TPR_2 repeat protein; Stage II sporulation D domain
FT                   protein; KEGG: dde:Dde_1785 sporulation protein and related
FT                   proteins-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65845"
FT                   /db_xref="GOA:A8ZRS8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRS8"
FT                   /protein_id="ABW65845.1"
FT                   /translation="MWPVLLHAANGGLPAESDFLFAQAETQVAAGRYLEAIGLYQTVAD
FT                   TTPDAGEKARALLLVGYAHAQYLDQHDKALLYFDYILTNWPGSAAAEEALYRKGMVLYE
FT                   TERYAKAYQAFTAYQERYPHTGRRYTAGVWAESAANLAATQALRMNRESLAAVRKDTTV
FT                   RVLVAESADTVHLASGTRLTLTDTASGKTSMLRSQATTIGAKQGRLTINGKSTATTRCR
FT                   ITSPQPIAVNGTRYRGAVVVSADGGTVSAINHVDIEPYLYGVVPREMPASWPEQALMAQ
FT                   AVASRTYALYVKQKSADRSFDVRATTASQVYGGYDAEMPAANRAVDATQGQVLTYNGNL
FT                   IVAYFHANSGGYTECPENVWGAALPYLADRPDRYSREVPGSQWEFFLPYDEAQAQLARY
FT                   GVHVGGVRGFVFNGKSRSGRIQDVSVVSDAGVWHMPGNMFRLAIGSTRLKSMCFEAARS
FT                   DQGVLFRGAGYGHGVGMSQWGARTMALEGHDYKTILKHYYRNITIASLDR"
     atgtggccgg ttctgctcca cgcggccaac ggcggccttc cggcggaaag cgacttcctg        60
     tttgcccagg ccgaaaccca ggtggcggcg ggccggtacc tggaagccat cggcctttac       120
     cagaccgtgg ccgacaccac cccggacgcc ggggaaaaag cccgggccct tctgctggtg       180
     ggatatgccc atgcccagta cctggatcag cacgacaagg ccctgctcta cttcgactac       240
     attctgacca actggcccgg ctctgcggcg gccgaagaag ccctctaccg aaagggcatg       300
     gtgctttacg aaacagagcg gtatgcaaag gcataccagg cgtttaccgc ttatcaggaa       360
     cgctatcccc acaccggccg gcgatacacc gccggggtct gggctgaaag cgccgcaaac       420
     cttgcggcca cccaggcgct tcgcatgaac agggagagcc ttgcagcggt ccggaaagac       480
     accactgtcc gcgtgctggt tgcagaatcg gccgataccg tgcacctggc atcaggcacg       540
     cggctgaccc tcacggacac ggcctccgga aaaacatcga tgctccggtc acaggcgacc       600
     accattggtg ccaaacaggg ccggctgaca atcaatggaa aatccactgc cacgacccgg       660
     tgccgcataa catcccctca gcccattgcc gtaaacggca cccggtaccg gggcgccgtg       720
     gtggtgtcgg ccgatggcgg aaccgtttca gcgatcaacc acgtggacat tgagccctat       780
     ctttacggcg tggtgccccg ggagatgccg gcctcctggc cggaacaggc tctcatggcc       840
     caggccgtgg cttcccgcac ctatgccctt tatgtaaaac agaaaagcgc ggaccggtcc       900
     tttgatgtcc gggccaccac ggcctcacag gtctacggcg gatatgacgc ggagatgccg       960
     gcggccaatc gcgccgtgga cgccactcaa ggccaggtcc tgacctacaa cggcaacctg      1020
     atcgtggcct attttcatgc caacagcggg gggtacactg aatgcccgga aaacgtctgg      1080
     ggcgcggccc ttccctattt ggcggaccgg ccggaccgct acagccgtga ggtgcccggg      1140
     agccaatggg aattttttct gccctatgac gaggcccagg cgcagctggc ccggtacggg      1200
     gtgcacgtgg gcggcgtcag gggctttgta ttcaacggca aaagccggtc cggacggatt      1260
     caggatgttt cggtggtgtc ggacgcaggg gtatggcata tgccgggcaa catgttccgg      1320
     ctggccatcg gcagcacccg gctcaagagc atgtgctttg aagcggccag aagcgaccag      1380
     ggggtcctgt ttcgcggcgc cggatacgga cacggcgtgg gcatgagcca gtggggggcc      1440
     agaaccatgg ccttggaggg acatgactat aaaaccatac tgaagcacta ttaccggaac      1500
     atcaccatcg cctcccttga tcgttaa                                          1527
//

If you have problems or comments...

PBIL Back to PBIL home page