(data stored in ACNUC7421 zone)

EMBL: CP000859.PE358

CP000859.PE358       Location/Qualifiers
FT   CDS_pept        410474..411991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0358"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="TIGRFAM: apolipoprotein N-acyltransferase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: plu:plu1308 apolipoprotein
FT                   N-acyltransferase (ALP N-acyltransferase) (copper
FT                   homeostasis protein CutE)"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66168"
FT                   /db_xref="GOA:A8ZT04"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT04"
FT                   /protein_id="ABW66168.1"
FT                   /translation="MVLASLSGILFTVAFSVKPLWWVSFAALFPLLLSLDRARTWRAAA
FT                   VRMSLFSIVFSFGMGYWVFHALVGHYQLPAGTAVSFFILALVLPVWLMHLTIALFYRFL
FT                   NNRTPVFYALVVPCLWVLGDYVKGMIPLLVPWGDIGYALVDWGAYFQMADLGGVYLVSF
FT                   LVVMFNSLLVCLMECRPQTNDLFRRRPMKGRAGTAVLILLVLILLVPLCYGSVRRYRMP
FT                   VLSLAGEKTPAVIAQGNFSHKDRWGGLGFYQRLKTYIELSGDPSDMGKAGVIVWPETVL
FT                   NHPEALTGPFFADLARILGKENLLIAGGLKRDSQSQGVYNSVYVIEDGQLKRYDKHILL
FT                   PYSERGPAVGPLFRFYNAPDRFIPGTTPACLSTSHGRVGLSVCFEILYPGYVRLSVKQG
FT                   AEFLVNVSNDAWFGDSAMPRAHLRAARARAVETGRWLLRASNSGISAVIAPNGSLTAGS
FT                   DLFRTQRISGSFTRLTTTTVYTRWGEWLFFFCLAVPAISLLRAGVRR"
     atggttcttg cctccctgtc cggcatcctc tttacggttg ccttttccgt aaaaccgctc        60
     tggtgggttt cttttgcggc gctctttccc ctgctgttgt cccttgaccg ggcaagaacg       120
     tggagagctg ctgctgtccg gatgtccctg ttctcgattg tgttttcttt tggcatgggc       180
     tactgggtgt tccatgccct ggtcggtcat taccagttgc ccgcgggcac ggcggtatct       240
     tttttcattc tggcgctggt ccttccggtc tggctgatgc acctgacaat tgcccttttt       300
     taccggttct taaacaaccg gacccctgtt ttttatgccc tggtggtgcc atgcctgtgg       360
     gtgctcggcg attatgttaa aggcatgata cccctgctgg tcccctgggg cgacatcgga       420
     tatgccctgg tggactgggg cgcctatttt cagatggccg acctgggagg ggtctacctg       480
     gtctcatttt tagtggtgat gttcaactcc ctgctggtct gcctgatgga atgccgcccg       540
     caaacgaatg atctctttcg ccggcggccg atgaagggcc gggccggaac cgcggtgctg       600
     atcctcctgg tgctgatcct cctggtgccc ttgtgctacg ggtccgttcg gcgttaccgg       660
     atgcctgtcc tgtctttggc cggggagaag acgcctgccg tcattgctca aggtaatttt       720
     tcacacaaag accgatgggg ggggctgggg ttttaccagc gactgaaaac ctatatcgaa       780
     ctcagcggcg atccgtcgga tatgggaaag gccggggtca ttgtctggcc ggaaaccgtg       840
     ctcaatcatc ccgaggccct gaccggaccg ttttttgcgg acctggcccg gatactggga       900
     aaagagaacc tgctgatcgc cggcgggctg aagcgtgaca gccagagcca gggcgtctac       960
     aattccgttt atgtgatcga agacggtcag ctgaaacggt acgacaagca catccttctg      1020
     ccctactcgg aaagaggacc ggctgtcggc cctttattcc gtttttacaa cgccccggac      1080
     cgttttattc ccggcacgac cccggcctgt ctgagcacct cccatggcag ggtggggctg      1140
     tccgtctgct ttgagatcct ctatccgggt tatgtccggc tgtccgtaaa acagggcgcc      1200
     gaatttctgg tcaatgtctc caatgacgcc tggttcgggg attcggccat gccccgggcc      1260
     catctgcggg cggcccgggc ccgggccgtg gagaccggcc gctggctgct gcgggcgtca      1320
     aacagcggca tttccgccgt gatcgcgccg aatggaagcc tcactgccgg cagtgacctg      1380
     tttcgcaccc agcggatttc aggatcgttt acgcgtctga cgacaacaac ggtttacaca      1440
     cgatgggggg agtggctctt cttcttttgt ctggcggttc cggcaatcag cttattacgg      1500
     gcgggtgtcc ggcgttga                                                    1518
//

If you have problems or comments...

PBIL Back to PBIL home page