(data stored in ACNUC7421 zone)

EMBL: CP000859.PE359

CP000859.PE359       Location/Qualifiers
FT   CDS_pept        complement(411968..413062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0359"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pae:PA2863 lipase modulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66169"
FT                   /db_xref="GOA:A8ZT05"
FT                   /db_xref="InterPro:IPR004961"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT05"
FT                   /protein_id="ABW66169.1"
FT                   /translation="MGVKGRMIFTIAGLLLLGLLVALYTRQPAPEEAAYIFDRDTGPAI
FT                   EQVAQSKEQMATIRAHQKPVQDDETGPAESDALIKDLFSQIIIGSGTTLHYFTWLGHEF
FT                   RRATSREDHLAQVKDRIFSQFPAEEAGRLYATYQRYLDCEMAVADLAARFGPITTTESG
FT                   LELLREVQEFRRDFLGTELADRLFGEQVKEKEYSLRRAAIVSDPDLYAEEKQAAMDRLT
FT                   QEMWGEAAGTEISLQPPTAYARYQDALAIYQKDLDEIAEEDDRRAAIEDIRNRYLPPDA
FT                   VERINAMEQQQAEEQQAEEAYFAAEKGIAEDTTLSEDQKAEQIESLRQEMLGDQAGAMK
FT                   RRQAIENAREAMLNQIGSTPDTRP"
     atgggcgtta aaggcagaat gatatttacc attgcaggcc tgctgctgct gggcctgctg        60
     gttgcgctgt ataccaggca gcctgcgccg gaagaggcgg cctatatttt tgaccgtgac       120
     accggcccgg ccattgagca ggttgcgcaa tcaaaagaac agatggcgac tataagggcc       180
     caccagaagc ctgttcagga cgatgaaaca ggcccggcgg aatcagacgc cctcatcaaa       240
     gacctttttt cccagatcat catcggttcg ggaaccaccc tgcactattt tacctggctg       300
     ggtcatgagt ttcgccgggc aacttcccgc gaagaccatc tggcccaggt caaagatcgt       360
     attttttccc agtttcctgc cgaggaggcc ggccggcttt acgcaacgta tcagcggtat       420
     ctggattgcg aaatggcggt cgccgatctt gcggcgcgct tcgggccgat caccacaacc       480
     gaaagcggcc tggagctgtt acgggaggtc caggaatttc gccgggattt tctgggcacc       540
     gaactggcgg acaggctttt cggagagcag gtaaaggaaa aggaatacag tttgcggcgg       600
     gccgccattg tctctgaccc ggacctttat gccgaagaaa aacaggcggc gatggaccgg       660
     ctgacacagg agatgtgggg cgaagccgcg ggcactgaga tatcccttca gccgccaacc       720
     gcctatgcca ggtaccagga tgccctggcc atttatcaga aagacctgga tgaaatcgcc       780
     gaagaagacg atcgccgggc cgccattgag gatattcgca accggtacct gccgccggac       840
     gcggtcgaac gcataaacgc catggagcag cagcaggccg aagagcagca ggccgaagag       900
     gcgtattttg ctgcggaaaa agggattgcc gaagacacga cgctgtctga agaccagaag       960
     gccgaacaga tcgagtctct tcgccaggag atgctcggtg accaggccgg ggccatgaaa      1020
     cggcggcagg ccattgaaaa tgccagagag gccatgctca accagatcgg gtcaacgccg      1080
     gacacccgcc cgtaa                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page