(data stored in ACNUC7421 zone)

EMBL: CP000859.PE36

CP000859.PE36        Location/Qualifiers
FT   CDS_pept        42966..43844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0036"
FT                   /product="protein of unknown function DUF400"
FT                   /note="PFAM: protein of unknown function DUF400; KEGG:
FT                   sat:SYN_02890 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65846"
FT                   /db_xref="InterPro:IPR024952"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRS9"
FT                   /protein_id="ABW65846.1"
FT                   /translation="MKKRAYLIGMVAAMFLLAPVWGFCQWGDALVESMPNGSVNWSTGI
FT                   IQAKGIGAPPESFYGKPQARPMAMRAAQLDAYRNLLEITQGVRVNSTTLVKNYVTENDI
FT                   IMTKVDGLVKGAQVTNTEYMSDGTVEVTLQMSLNGDLARVVLPPEVGSQEPMPPAAPEM
FT                   MPPQEAPAPAPETPAPAVYTGLVVDAKGLGAKPAMAPKILDSEGREVYGSAYVSREYAV
FT                   SQGMSGYAKQLESATANQRVTDNPLVVKGVKTEGPGQCDIVISSADAEMLKSAAENLSF
FT                   LEKCRVMIVVD"
     atgaaaaaaa gagcgtatct tatcggtatg gtggccgcga tgtttctgct ggcgcccgtc        60
     tggggtttct gtcagtgggg tgatgcactg gtcgagtcca tgcccaacgg atcggtgaac       120
     tggtctaccg gcattattca ggccaaaggc atcggcgctc cgccggaaag tttttacggc       180
     aagccccagg cccggcccat ggccatgcgg gcggcccagc tggacgccta ccgcaacctg       240
     ctggaaatca cccagggcgt gcgggtcaac agcaccacgc tggtaaaaaa ctatgtcacg       300
     gaaaacgata tcatcatgac caaggtggat ggcctggtca agggcgccca ggtgacaaac       360
     accgaataca tgtcagacgg caccgttgag gtgaccctgc agatgagttt aaacggcgac       420
     ctggcccggg ttgttctgcc gccggaagtg ggcagccagg agcccatgcc gccggccgcg       480
     ccggagatga tgccccccca ggaggccccc gcccccgcgc cggaaacccc tgctccggct       540
     gtttacaccg gcctggtggt ggacgccaag ggcttgggcg caaaaccggc catggcaccc       600
     aaaatcctgg attcagaggg ccgggaagtc tatggctcgg cctatgtcag ccgggagtat       660
     gccgtgtccc agggcatgag cggatatgcc aagcagcttg aatcggccac ggccaaccag       720
     cgggtgaccg acaatcccct ggtggtcaag ggtgtaaaaa cggagggacc gggacagtgc       780
     gacatcgtga tcagcagcgc cgatgccgag atgctgaaaa gcgcggcgga aaacctgtcg       840
     tttcttgaaa agtgccgggt catgattgtt gtggattaa                              879
//

If you have problems or comments...

PBIL Back to PBIL home page