(data stored in ACNUC7421 zone)

EMBL: CP000859.PE364

CP000859.PE364       Location/Qualifiers
FT   CDS_pept        complement(420485..421813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0364"
FT                   /product="protein of unknown function DUF362"
FT                   /note="PFAM: protein of unknown function DUF362; KEGG:
FT                   chy:CHY_1734 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66174"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT10"
FT                   /protein_id="ABW66174.1"
FT                   /translation="MKKHTVSVVKYEKPLESVRKAVDLAGGLDHLPPKAKVFLKPNIVF
FT                   WSKAVAFPKWGVITTSRVIEDMVVLLKERGIDDITIGEGIVCDPKDKETPVHAFKTLGY
FT                   ETLAKKYGIRHINVFDHDFEPVDLGDGVEFSFNTDMLHSDFVVDLPVMKTHNQTVVSLG
FT                   IKNLKGVMDIPSRKKAHSPDAVKDLYFSIARLPDKLPPMLTLIDGIYTLERGPGFDGKP
FT                   RPSNILVASTDVLSADMVGAKILGHDPAAIAYMVHAAANHNRPTDLSDVEVAGEPIDSV
FT                   AAFHEYDFAYHEDADRCIPAPLVKDGIKGLYYRKFDSTMCTYCAAMNGIILSAIRYAWK
FT                   GEPWDNIEVLTGKKMAPTPGMNKTILVGKCMYQEHKDNPVIQEMIPIKGCPPEPKTILK
FT                   ALLQAGIDANPALFEQIDQLPAFFMQKYAGNPEFDEAFFQVAP"
     atgaaaaaac acaccgtatc tgttgtcaaa tacgaaaaac cattggaatc ggtcagaaaa        60
     gccgttgatc tcgccggtgg cctggaccat ctgcccccaa aggcaaaagt ctttctcaag       120
     cccaatatcg tgttctggtc aaaggcggtg gcctttccca agtggggggt gatcaccacc       180
     tcacgggtca ttgaggacat ggtggtgctg ttaaaggagc gcggcatcga cgacatcacc       240
     atcggtgaag gcattgtgtg cgacccgaaa gacaaagaga ccccggtcca cgcctttaaa       300
     accctgggct atgaaaccct ggcaaaaaag tacgggatcc ggcatatcaa cgtgtttgac       360
     cacgactttg agccggtgga cctgggcgac ggtgttgaat tttcctttaa caccgacatg       420
     ctgcacagcg atttcgtggt ggatctgccg gtgatgaaaa cccacaacca gaccgtggtg       480
     agcctgggca tcaagaacct caaaggggtg atggacattc cctcccgcaa aaaggcccac       540
     agcccggacg cagtaaagga cctctatttt tccattgccc ggctgcccga caaactgccc       600
     cccatgctca ccctgatcga cggcatttac accctggagc gggggcccgg ctttgacggc       660
     aagccccggc ccagcaatat cctggtggcc tccaccgacg ttctgtccgc ggacatggta       720
     ggcgcgaaaa ttctgggcca cgatccggcc gccattgcct acatggttca tgccgcggcc       780
     aaccacaacc ggcccacgga cctgtccgac gttgaggtgg cgggcgagcc catcgacagc       840
     gtggccgcgt ttcacgaata tgactttgcc tatcacgagg acgcggaccg gtgcattccg       900
     gcgcccctgg tcaaggacgg catcaagggg ctgtattacc gcaaatttga ctccaccatg       960
     tgcacctact gcgcggccat gaacggcatc atcctgtcgg ccatccggta cgcgtggaaa      1020
     ggcgagccct gggacaacat cgaggtgctt accggaaaga aaatggcgcc caccccgggc      1080
     atgaacaaaa ccatcctggt gggaaagtgc atgtaccagg aacacaaaga caacccggtg      1140
     atccaggaga tgattcccat caagggatgc ccgcccgagc ccaaaaccat tctaaaagcc      1200
     ctgctccagg ccggcatcga cgccaacccg gccctgtttg agcagatcga ccagctgccc      1260
     gcctttttta tgcaaaagta tgccggcaat cccgaatttg acgaggcgtt ttttcaggta      1320
     gcgccttaa                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page