(data stored in ACNUC7421 zone)

EMBL: CP000859.PE366

CP000859.PE366       Location/Qualifiers
FT   CDS_pept        423151..423582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0366"
FT                   /product="S23 ribosomal protein"
FT                   /note="PFAM: S23 ribosomal protein; KEGG: rba:RB10686
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66176"
FT                   /db_xref="GOA:A8ZT12"
FT                   /db_xref="InterPro:IPR012657"
FT                   /db_xref="InterPro:IPR036583"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT12"
FT                   /protein_id="ABW66176.1"
FT                   /translation="MALGHEKLDVYRLAIRYVAWVYENAGHLNGVHRSAREQWLRASQS
FT                   IPLNIAEGNGKTAGADRRRYFEIARGSALECAAIQDVLVVGRGLQEEESRERKLELDRI
FT                   VAMLSRLGGRGYCVGEEAEPYGHDENDPDPDSDPDGNRP"
     atggcactgg gacacgaaaa actggacgtt taccgtcttg ctatccgtta tgtcgcctgg        60
     gtttatgaaa atgccggcca cctgaatggg gtccatcggt ccgcgcgaga gcagtggctt       120
     cgcgccagtc agtcgatacc gctgaacatt gccgaaggaa acggcaaaac agcgggggcg       180
     gatcgaaggc ggtactttga aatcgcccgt ggttcggcgc tggagtgcgc cgcaattcag       240
     gatgttctgg tggtcggaag gggattgcaa gaagaagaga gccgggaacg caaacttgaa       300
     ctggatcgta ttgtcgccat gctcagccgt ttgggtggta gaggttattg cgtcggtgaa       360
     gaggccgaac cctacgggca tgacgaaaac gatcccgatc ccgatagcga tcccgatggc       420
     aacagaccat ag                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page