(data stored in ACNUC7421 zone)

EMBL: CP000859.PE368

CP000859.PE368       Location/Qualifiers
FT   CDS_pept        425698..426462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0368"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: noc:Noc_0154
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66178"
FT                   /db_xref="GOA:A8ZT14"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT14"
FT                   /protein_id="ABW66178.1"
FT                   /translation="MTSTPYQITFPKGPPADAGQGDQCFCVTTPDGNRQTIRCHDYGLI
FT                   YSLPGLYEQVFCDRLACVSPQKVADVLEKVVGLCDVRVADLRVLDLGAGNGLVGEALSA
FT                   KGVGRLVGADIIPEARMATERDRPGIYDAYYVTDFCRLSQEETAAFQSWSFNCLITVGA
FT                   LGFDDIPPRAFVAAYNMVETGGWVAFNIREDFLDKTDTSGFAGLVREMLFSRHMTVHHL
FT                   ERYRHRLSTDGRPLFYLAVAGRKRAHLPETAL"
     atgacgtcta cgccatacca gatcacgttt ccaaaaggcc cgcctgccga tgcggggcag        60
     ggggaccagt gcttctgcgt gacaacgccc gatggaaacc ggcagaccat ccgctgccat       120
     gattatggtc ttatttattc tctgcccggg ctttacgagc aggtgttctg tgaccggctt       180
     gcctgcgtct ctcctcagaa ggtggccgac gtgctggaaa aagtggtggg cctgtgcgat       240
     gtccgggtgg cagacctgcg cgtactggac ctgggtgcgg gcaacggcct ggtgggagaa       300
     gccctgtcgg caaaaggggt gggccggctg gtgggcgcag acattattcc cgaggcccgc       360
     atggccacgg agcgggaccg gcccggcatt tacgatgcct attacgtgac cgacttttgc       420
     cggttgtctc aagaggagac agcggctttt caatcctggt cttttaactg cctgatcacc       480
     gtgggggctc ttggctttga cgacattccg ccccgggcct ttgttgcggc ctacaacatg       540
     gttgagacgg ggggatgggt ggccttcaat atcagggaag attttcttga caagactgat       600
     accagcgggt ttgccggcct ggtccgggaa atgctctttt cccggcacat gacggttcac       660
     cacctggaac ggtaccggca ccgcctctcc acagacggcc gtcccctgtt ctaccttgcc       720
     gttgccggca gaaaacgggc ccacctgccg gaaactgccc tctga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page