(data stored in ACNUC7421 zone)

EMBL: CP000859.PE377

CP000859.PE377       Location/Qualifiers
FT   CDS_pept        435563..437083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0377"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mpt:Mpe_A0094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66187"
FT                   /db_xref="GOA:A8ZT23"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT23"
FT                   /protein_id="ABW66187.1"
FT                   /translation="MNKNRRNSVLSSPYVWTFTTYFAEGFPYTVIRTLSSLFLRDMNVR
FT                   LESIGLTSLFGLPWILKFLWGPQVDRFSTKRTWMLTCQFLLVGMMLLTAAFAPFSWGVS
FT                   AIVLLFFAGSFIAATHDTAIDGFYMEALDSEGQAKFVGYRVMAYRIAMMTGTGVVATIG
FT                   TTLGWPLAFACAALMMGLVFVYHFFFLIRVEQQGRPANELVKSALRLKNLALVTGAALL
FT                   VLGLRAFLASRPYALIREQYPVLQKISFPHWVGLFLLLSLISLLVLRKRIWARIAGKPD
FT                   TFYARAFITFTDREKIGTIFAVIILMRTGEFLLTAMVSPFFVDVGIKVHYGWLSSVVGL
FT                   PLSIAGALVGGFCISTFSLKKVIWPFLLLQNLTNLVYMVLALHLAPFVAINTGAAVAQP
FT                   VGALNLFWVAVVHGFDQFSGGLGTAVLMTFLMRICAKEFKAAHYAIGTGLMNVSGLFAG
FT                   ILSGFLAGWLGYGYFFGISFLLSVPGMIAVLFLPADIYVEPSKPAPKN"
     gtgaataaaa atcgacgaaa ctccgtcctc tcctctccct atgtctggac ctttaccacc        60
     tattttgccg aaggctttcc ctataccgtc atccgcacgc tctcctcgct tttcttaaga       120
     gacatgaatg tccggctgga gtccatcggc ctgacctccc tgttcggcct gccctggatt       180
     ttaaaattcc tgtggggacc ccaggtggac cggttttcca ccaagcggac ctggatgctg       240
     acctgccagt tcctcctggt gggaatgatg ctgctgacag ccgcctttgc cccgttctcc       300
     tggggcgttt ccgccattgt cctgctcttt tttgccgggt cttttattgc cgccacccac       360
     gacaccgcca ttgacggctt ttacatggag gccctggaca gtgagggcca ggcaaaattt       420
     gtgggctacc gggtcatggc ctaccgcatc gccatgatga ccggcaccgg cgtggtggcc       480
     accatcggca ccaccttggg ctggcccctg gcctttgcct gtgcggccct gatgatggga       540
     ctggtgtttg tgtaccactt ttttttcctg attcgggtgg agcagcaggg ccggccggcc       600
     aatgagctgg taaaatccgc ccttcggttg aaaaaccttg cccttgtgac cggcgccgcc       660
     cttctggtcc tgggcctgcg ggcttttctg gcctcccggc cctatgccct gatcagggag       720
     caatacccgg tgctgcagaa aatcagtttt ccccactggg tgggcctctt tctgctgctg       780
     tccctgatca gcctgctggt gctgcgaaaa cggatctggg cccgcattgc cggcaaaccg       840
     gacacctttt acgccagggc ttttatcacc tttaccgaca gggaaaagat cggcaccatt       900
     ttcgctgtta tcatcctgat gcgcaccggc gaatttctgc tcacggccat ggtctctccc       960
     tttttcgtgg acgttggcat caaggtccat tacgggtggc tctcgtcggt ggtgggcctg      1020
     cccctctcca ttgccggggc tctggtggga gggttttgca tctccacctt ttcgctgaaa      1080
     aaagtgatct ggcccttttt gctgctgcag aacctcacca acctggttta catggtgctg      1140
     gccttacacc ttgccccgtt tgtggccatc aacaccggcg cggccgtggc ccagcctgtt      1200
     ggcgcgctta acctcttctg ggtggccgtg gtgcacgggt ttgaccagtt ttccggaggc      1260
     ctgggcacgg ccgtgctcat gacctttctg atgcgcatct gcgcaaaaga gttcaaggcg      1320
     gcccattacg ccatcggtac cgggctgatg aatgtttccg gcctgtttgc cggcattctc      1380
     agcgggtttc tggccgggtg gctggggtat ggatattttt tcggcatcag ctttctttta      1440
     tccgtgcctg gcatgatcgc cgtcctgttt ctgcccgccg atatttacgt tgaaccctcg      1500
     aaaccggcac cgaaaaattg a                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page