(data stored in ACNUC7421 zone)

EMBL: CP000859.PE379

CP000859.PE379       Location/Qualifiers
FT   CDS_pept        complement(439399..440295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0379"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /EC_number="2.1.1.63"
FT                   /note="KEGG: sfu:Sfum_1600 quinolinate synthetase complex,
FT                   A subunit; TIGRFAM: quinolinate synthetase complex, A
FT                   subunit; PFAM: Quinolinate synthetase A"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66189"
FT                   /db_xref="GOA:A8ZT25"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT25"
FT                   /protein_id="ABW66189.1"
FT                   /translation="MIQQRISDLKARRNAIILVHNYQPPEIQDIADFCGDSLELSIRAA
FT                   ETDADVIVFCGVHFMAETASIVCPDKTVLLPDFNAGCPMADMITPQALAAKLKELGDMP
FT                   VVTYVNSPAAVKAMSTVCCTSANVVKVVNSLEEKEILMTPDRNLATYAQGYTDKTLHLW
FT                   PGWCPVHDALRPEDIETARRDHPGALVMAHPECRPEVTALADAVLSTSGMLRHAAESDR
FT                   TEFIVATENGILYPLQKACPDKRFYWASESMVCPDMKKIGLADVAACLETLAPEVKVPR
FT                   EIQQKALAAVQRMLEIV"
     atgattcagc agcgtatcag tgacctcaag gcccggcgca acgccattat actggtgcat        60
     aactaccagc cgcccgagat ccaggatatc gccgatttct gcggtgactc cctggaactt       120
     tccattcggg ccgccgaaac cgacgccgat gtgatcgtct tctgcggggt ccattttatg       180
     gccgaaaccg cgtccatcgt ctgcccggac aagaccgtgc tgctgcccga ctttaacgcg       240
     ggctgcccca tggccgacat gatcacgccc caggcccttg cggcaaaact gaaggaactg       300
     ggcgatatgc cggtggtgac ctatgtcaac tccccggccg cggtcaaggc catgtctacg       360
     gtctgctgca cgtcggccaa cgtggtaaaa gtggtcaaca gcctggagga aaaagagatc       420
     ctcatgaccc cggaccggaa cctggccacc tatgcgcaag ggtataccga caaaaccctt       480
     cacctgtggc ccggctggtg tcccgtacac gacgccctgc ggccggagga tatcgagacg       540
     gcccggcgcg accatcccgg cgccctggtc atggcccacc ccgagtgccg gcctgaagtg       600
     acggccctgg ccgacgcggt gctttccacc tccggcatgc tgcgccatgc cgctgaatcg       660
     gaccggaccg aatttatcgt ggcaacggaa aacgggattc tttatccgct tcaaaaagcc       720
     tgtccggaca agcggttcta ctgggcctcg gaatccatgg tatgcccgga catgaagaag       780
     atcgggcttg cggatgtggc agcctgcctg gagaccctgg cgccggaggt caaggtgccc       840
     cgcgagattc agcagaaggc cctggcagcg gtgcagcgca tgctggaaat tgtgtga          897
//

If you have problems or comments...

PBIL Back to PBIL home page