(data stored in ACNUC7421 zone)

EMBL: CP000859.PE38

CP000859.PE38        Location/Qualifiers
FT   CDS_pept        45095..45967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0038"
FT                   /product="putative periplasmic protein"
FT                   /note="KEGG: sat:SYN_03044 putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65848"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRT1"
FT                   /protein_id="ABW65848.1"
FT                   /translation="MKRMKILYGMVLAAFVAGLLVLPVQAGPVGVGISDGPAVISVLDG
FT                   SAALVDGQQKTLRSLSQGEALNQGDRIRVGDQSRIELRLPDGSFVRFDSNSVFELKAMA
FT                   VDSRDNRRDINVNVVFGKIWASVSKWVSGSSRFDVSMKTTTAGVRGTAYRVNVNSDDSA
FT                   VVKVYDGTVEVKGATGEEASAPQAAGAPAALSAPRPVAGPTPVAGPHPVSMEQWVYTLK
FT                   AMQQIVIRPDGTATPPFRFSYEADRNDWVEWNRQRDTAVGMPVPEPPAADAAPVEYTPS
FT                   PAVPESNQP"
     atgaaacgaa tgaaaattct ttacggtatg gtgctggccg cctttgtggc cggcctgctt        60
     gtcctgccgg tccaggccgg acccgtgggc gtgggcatca gcgacggccc ggctgtcatc       120
     tccgtccttg acggcagcgc ggccctggtg gacggccagc agaagacgct gcgctccctt       180
     tcccagggag aggcgctgaa ccagggagac cggattcgag tcggcgatca atccaggatt       240
     gaactccggc tgccggacgg cagtttcgtg cggtttgaca gcaacagcgt gtttgaactc       300
     aaggccatgg ccgtggactc ccgggacaac cggcgggaca tcaacgtaaa cgttgtgttc       360
     ggcaaaatct gggcctcggt ttccaagtgg gtctccggca gcagccggtt tgatgtctcc       420
     atgaaaacca ccaccgctgg tgtgcggggc acggcctacc gcgtcaacgt gaacagcgac       480
     gactcggccg ttgtcaaggt gtatgacggc accgtggagg tcaagggggc caccggcgaa       540
     gaggcttcgg ccccgcaggc ggcgggcgcg cccgccgcgc tttccgcgcc ccggcccgtg       600
     gccggcccca ccccggtggc aggcccccat ccggtttcca tggaacagtg ggtttacacc       660
     ctgaaagcca tgcagcagat cgtcattcgg cccgacggca ccgccacccc gcccttccgc       720
     ttttcctacg aggcggaccg aaacgactgg gtggagtgga accgtcagcg ggacacggct       780
     gtcggcatgc cggtgcctga accgcccgcc gcggatgccg ccccggttga gtacacaccc       840
     tctccggccg tgcctgaatc caatcagcct tag                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page