(data stored in ACNUC7421 zone)

EMBL: CP000859.PE385

CP000859.PE385       Location/Qualifiers
FT   CDS_pept        444930..445187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0385"
FT                   /product="Smr protein/MutS2"
FT                   /note="PFAM: Smr protein/MutS2; KEGG: afw:Anae109_4369 Smr
FT                   protein/MutS2"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66195"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT31"
FT                   /protein_id="ABW66195.1"
FT                   /translation="MDLHTFAPSEVGDLLKDYLAECQKAGIFSIRVVHGKGTGVLKKRV
FT                   WAALAKNALVDRFHEAPPEAGGWGATIVEIKKVSPDIRHT"
     ttggacctgc acacctttgc cccctcagag gtgggcgacc tgctgaaaga ctacctggcc        60
     gagtgccaaa aggccggcat tttttccata cgggtggtgc acggcaaggg caccggcgtt       120
     cttaaaaaac gggtgtgggc ggccctggct aaaaacgcat tggtggaccg gtttcacgaa       180
     gccccgcctg aagccggcgg ctggggcgcg accatcgtgg agataaaaaa agtatcgcct       240
     gacatacggc acacctga                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page