(data stored in ACNUC7421 zone)

EMBL: CP000859.PE389

CP000859.PE389       Location/Qualifiers
FT   CDS_pept        447704..448603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0389"
FT                   /product="membrane-bound lytic murein transglycosylase
FT                   B-like protein"
FT                   /note="KEGG: sfu:Sfum_3035 membrane-bound lytic murein
FT                   transglycosylase B-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66199"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT35"
FT                   /protein_id="ABW66199.1"
FT                   /translation="MRFFSFILQLLLPALLLGVAGCTAPPAPPVYVDFETAAPFDRLCA
FT                   KLEKDGFDGQVLRRYYTHPDVAFEQAGTALFFHHSESKLNYDQFLKTASLNRAREYLQA
FT                   QGRWLTAAQNTYTVDKEVITAILLVETRFGAYLGTRPAFNILSSMASLADPAMEAEFWQ
FT                   SIEKTTTFTPEAYNKRVRDKSKWAYNELKAFLAYVEKENIENPVSLKSSYAGAMGISQF
FT                   MPSNILKLGVDGDNDGRVDLFTHPDAIFSVASFLAHHGWKPGLDHQAAYKVLLNYNYSR
FT                   PYAETVLKIRERLKAGPS"
     atgcgttttt tttcttttat attacagctt ctgctgccgg ccctgttgct gggggttgcg        60
     gggtgtacgg ccccgccggc tccgccggtt tatgtcgatt ttgagactgc cgcgcccttt       120
     gaccggcttt gcgcaaaact ggaaaaagac gggtttgacg gccaggttct gcggcggtat       180
     tacactcatc cggatgtggc ctttgagcag gccggcacag ccctgttttt tcaccacagt       240
     gaatcaaagc tgaattacga ccagttttta aaaaccgctt ccctgaaccg ggcccgggaa       300
     tacctgcagg cccagggccg ttggctgaca gcggcccaga acacctacac cgtggacaaa       360
     gaggtgataa ccgccattct tctggtggaa acccggttcg gcgcctacct tggcacccgg       420
     ccggccttta acattctctc ttccatggcc tcccttgccg acccggccat ggaggcggag       480
     ttctggcagt ccatcgaaaa gaccacgacc ttcacaccag aggcctataa caagcgggtg       540
     cgggacaaat ccaagtgggc gtacaacgaa ctcaaggcgt ttctggccta tgtggaaaaa       600
     gaaaacattg agaatcccgt gtccctgaaa agctcttatg caggggccat gggaatctcc       660
     cagttcatgc ccagcaacat tctcaaactg ggcgtggacg gcgacaatga cggccgggta       720
     gacctgttca cccatccgga cgccatcttc agcgtggcct cctttctcgc ccaccacgga       780
     tggaaaccgg gcctggacca ccaggccgcc tacaaggtcc tgctcaacta caactacagc       840
     cggccttacg ccgaaaccgt attgaagata cgcgaacggc tcaaggccgg accctcctga       900
//

If you have problems or comments...

PBIL Back to PBIL home page