(data stored in ACNUC7421 zone)

EMBL: CP000859.PE393

CP000859.PE393       Location/Qualifiers
FT   CDS_pept        453039..453884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: acb:A1S_1771 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66203"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT39"
FT                   /protein_id="ABW66203.1"
FT                   /translation="MLFKSKPIVSALVPVEKISEDLIREMHSLFIEYYENADYDTFKQD
FT                   LGAKTGSFLWRERKTGRLIAFANIRLMKLPYKKRHVHVFFCGDTVCHRDYWQRNASGNS
FT                   PMAATVYGFLLRFMMKHPFSTYWFMISMSFRTYLVIANNMVHHYPHYERTDAKVQKLKE
FT                   ICHLVAGHMYGDKFDPETGRVDFGRKDENQTIKSDVAPVTPEMLEKYPKIRFYESLNPD
FT                   NQKGVELACIGAIDIDSITAYCKKFLRRTWDGLTARGKVTTLPSTAALDRNQEKKKKAA
FT                   "
     atgctgttta aatccaaacc cattgtgtcg gccctggtgc cggtggaaaa gatttccgaa        60
     gacctgatcc gtgaaatgca cagcctgttt atcgagtatt atgaaaacgc cgattatgac       120
     acctttaaac aggaccttgg cgccaaaacc ggttcctttc tgtggcggga acgaaaaacc       180
     ggccggctga tcgcctttgc caacatccgg ctcatgaaac ttccctataa aaaacgtcat       240
     gtccatgttt ttttctgcgg cgacacggtg tgtcaccgcg actactggca gcgcaacgcc       300
     tccggcaaca gccccatggc cgcaacggtc tacggatttc tgctccgttt tatgatgaaa       360
     caccccttca gcacctactg gttcatgatc tccatgagct ttcgcaccta cctggtcatc       420
     gccaacaaca tggtccatca ctacccccat tacgaacgca ccgatgccaa ggtccagaag       480
     ctcaaagaga tctgccatct ggtggccggc catatgtatg gcgacaagtt tgacccggaa       540
     accgggcggg tggacttcgg ccggaaggac gaaaatcaga ccatcaaaag cgatgtggcc       600
     ccggtcaccc ctgaaatgct ggagaaatat cccaagatcc ggttctacga atcgttgaat       660
     ccggataatc aaaagggcgt tgaactggcc tgtatcggcg ccatcgacat tgattcaatc       720
     actgcttatt gcaaaaagtt tttgcgccgc acctgggacg gcctgaccgc caggggtaaa       780
     gtgacaaccc tgccgagcac ggctgcattg gaccggaacc aggagaaaaa gaaaaaggcg       840
     gcataa                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page