(data stored in ACNUC7421 zone)

EMBL: CP000859.PE394

CP000859.PE394       Location/Qualifiers
FT   CDS_pept        453936..455579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0394"
FT                   /product="GH3 auxin-responsive promoter"
FT                   /note="PFAM: GH3 auxin-responsive promoter; KEGG:
FT                   aci:ACIAD3676 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66204"
FT                   /db_xref="InterPro:IPR004993"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT40"
FT                   /protein_id="ABW66204.1"
FT                   /translation="MDMLTNIAHQAAMAVSQKGYRTYTSGLADIRPHQQRILASILRAV
FT                   RGSASGRYYGLTGEESIERFRAKVPLTEYAHWEKQIERQKKTGEPVLSTSPCERYQPTS
FT                   GSTSDIKWIPYTRQFLSQVDAFISPMIYRMYRQYPGIRKGVHYWSLSWIPTELRSHISP
FT                   NINDDLKLLPWWKRMFMSLTMAVPDSVAHAPTSEASMFATACYLCAAENLSLVSVWSPT
FT                   FLLSMLDLISDHRREMASVLASGAWGEARQSLAYLPCPRSRHGADILANREAELSPKTL
FT                   SRLWPGLRVISAWDTWTSTPWASKIKELFPFAVLEGKGLLATEGIVSMPFDGQYPLTYQ
FT                   CHFYEFVDWHSGDILNAWELKKGQVVQPVLTTGAGLLRYLLHDRLEVTGFLQSCPCFLF
FT                   LGRSDGVDLVGEKMSPEAAGRVLNRISDTYSSVRPVSLLAVPSSHSGATDGYVLLCEGD
FT                   ETAPAGDIAERAEKELRGIYHYNLARDLGQLAHLKCVVSPAATAIYQSRAAARGMVAGN
FT                   LKIEPVVLWNCALPGPLCNAFAGPVDARVN"
     atggatatgc ttaccaacat cgctcaccag gccgccatgg cggtttcaca aaagggatac        60
     cggacctaca catcggggct ggccgatatt cggccccatc agcagcgcat actggcttcc       120
     atcctcaggg ccgtcagggg gtctgcgtcc ggccggtatt acggcctgac cggagaggaa       180
     tccattgagc ggtttcgggc gaaagtcccc ctgaccgagt atgcccactg ggaaaaacag       240
     attgagcggc agaaaaagac cggggagccg gttctcagca ccagcccctg cgagcggtat       300
     cagcccacca gcggttccac gtcggacatt aagtggattc cctacacccg gcagttcctg       360
     tcccaggtgg acgcttttat ttcaccgatg atctaccgca tgtaccggca gtaccccggc       420
     attcgaaagg gggttcacta ctggtctctt tcatggattc caacagagct gcgcagccat       480
     atcagcccga acatcaacga cgatctgaag ctgctgccct ggtggaaacg gatgttcatg       540
     tctctgacca tggcggtgcc ggacagcgtg gcccacgcgc ccacgtcaga agcctccatg       600
     tttgccaccg cctgctatct gtgcgcggcc gaaaacctct ccctggtatc cgtgtggagc       660
     cccacgtttc tgctgagcat gcttgatctg atttccgacc atcgccggga aatggcctcg       720
     gtgctggcat caggcgcctg gggagaggcc cggcagtctc tggcctacct gccgtgcccc       780
     cgttcgcggc acggggccga catcctggca aaccgggaag cagagctgtc acccaaaacc       840
     ctctcccggt tatggccggg ccttcgggtg atcagcgcct gggacacgtg gacctcaacg       900
     ccatgggcaa gcaagataaa agagctgttt ccttttgccg tgctggaggg aaagggtctg       960
     ctggccaccg agggcattgt ctccatgccc tttgacggcc aatacccatt gacctaccag      1020
     tgtcactttt acgagtttgt ggactggcat tccggcgaca tcctgaacgc gtgggagctg      1080
     aaaaaggggc aggtcgtcca gccggtgctg accaccggcg ccggcctgct gcgatacctt      1140
     ttgcatgaca ggctggaggt gaccggtttt ctgcaaagct gcccctgctt tcttttcctg      1200
     ggccggtccg acggcgtgga cctggtcggt gaaaagatga gtcctgaggc ggccggccgg      1260
     gtgctgaaca ggatatcgga cacctacagc agcgtccggc cggtcagcct gctggccgtg      1320
     cccagcagcc attccggcgc caccgacgga tacgtgctcc tgtgtgaagg cgatgaaacg      1380
     gccccggccg gcgatatcgc tgaacgggcg gaaaaggaac tgcgcggaat ttatcactac      1440
     aacctggccc gggacctggg ccagctggcc catctgaaat gcgttgtgtc cccggcggca      1500
     accgcgattt accagtcccg ggccgcggcc cggggcatgg tggcgggcaa cctgaaaata      1560
     gagccggtgg tcctgtggaa ctgcgcgctt cccggccccc tgtgcaatgc ctttgccggg      1620
     ccggtggacg cacgggtgaa ttaa                                             1644
//

If you have problems or comments...

PBIL Back to PBIL home page