(data stored in ACNUC7421 zone)

EMBL: CP000859.PE398

CP000859.PE398       Location/Qualifiers
FT   CDS_pept        complement(459063..459893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0398"
FT                   /product="oxidoreductase of the aldo/keto reductase
FT                   family-like protein"
FT                   /note="KEGG: pai:PAE2929 aldo-keto reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66208"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT44"
FT                   /protein_id="ABW66208.1"
FT                   /translation="MEQTIQTAHGSFAKGVLGRTGLSVGRLGLAASYGAPPAAFEEAFE
FT                   RGCNYFYIGSGRRRANMKTAIRNICENGHREHLVVAVQTYARFGLLTETLFRRNLRSMG
FT                   LAHADILMLGWHNRRPAQRLMDMALRLKQNGLCRFIGMSGHSRGLFVQLTKEGVFDLFH
FT                   VRYNAAHRGAETETFPFLKGDSRPGVVSYTATRWGHLLKSEKMPEGEPPLRASDCYRFA
FT                   MSHPAVDVCLCGPSNMEQMREALTALDLGPLSEAEMERARRVGDHVHRHGGGFF"
     atggagcaga ccatacagac cgcgcacggg agttttgcga agggtgttct gggccgtacc        60
     gggctttccg tcgggcggct gggccttgcc gccagttacg gcgcgccgcc ggccgccttt       120
     gaggaggcgt ttgagcgggg gtgcaactat ttttacatcg gatcgggccg tcgccgcgcg       180
     aacatgaaaa ccgccattcg gaacatctgc gaaaacggtc accgggagca cctggtggtg       240
     gcggttcaga cctatgcgcg gttcggcctg ctgaccgaaa ccctgtttag aaggaatctg       300
     cgttcaatgg gcctggccca tgccgatatc ctgatgctgg ggtggcacaa ccggcggccc       360
     gcccaaaggc ttatggacat ggcgctgcgg ctaaaacaaa acggactgtg ccggtttatc       420
     ggcatgtccg gccattcccg cgggctgttt gtccaactga caaaagaggg cgtgtttgat       480
     ctgtttcatg tccgctacaa cgcggcccac cggggtgcgg aaacagagac ctttccgttt       540
     ttgaagggcg attcccggcc cggtgtggtt tcctacaccg ccacccggtg gggccacctg       600
     ctcaaatctg aaaaaatgcc cgaaggagag ccgccgcttc gggccagtga ctgctaccgg       660
     tttgccatgt cccatccggc cgtggatgtc tgcctgtgcg gcccgtcaaa tatggaacag       720
     atgcgcgagg ccttgacggc cctggatttg gggcccctgt ccgaggccga gatggaacgg       780
     gccaggcgcg tcggagacca tgtgcaccgc catggcggtg gctttttcta g                831
//

If you have problems or comments...

PBIL Back to PBIL home page