(data stored in ACNUC7421 zone)

EMBL: CP000859.PE400

CP000859.PE400       Location/Qualifiers
FT   CDS_pept        461188..462096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0400"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   sfu:Sfum_0024 periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66210"
FT                   /db_xref="GOA:A8ZT46"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT46"
FT                   /protein_id="ABW66210.1"
FT                   /translation="MVQPEQAMTRGMKKILFALVFFCLPALPAGAAEKLPVFVSIAPQK
FT                   YFVERIGGDHVAVSVMVAPGASPATYEPRPGQMRALSAAVLYFAIGVPFEQVWLPRIAA
FT                   ANPAMKIVRTDRGIEKRAMTHHAHDDGHAEAAVSHGGADPHIWLSPSLVKLQAATIANA
FT                   LKEADPAHAADYQVHADAFFAELEALDKELRNLFADATGARFLVFHPSWGYFADAYGLV
FT                   QVPMEVEGKEPKPGQLRDLIEHARKNRISVILVAPQFSSRSAQVLAEEISGTVAVADPL
FT                   AENWPDNLRTVARTIRGAVNR"
     atggtacaac cagagcaggc catgacacgc ggtatgaaaa aaatcctttt cgcgctggtc        60
     ttcttctgct tgccggctct gccggcagga gcagcggaga agctgccggt gtttgtcagc       120
     atcgcgcccc agaaatattt cgtggaacgg atcggcggtg atcatgtggc agtgtcggtg       180
     atggtggcgc cgggcgccag cccggccact tatgaacccc ggcccggcca gatgcgggca       240
     ctttcagcgg ccgttctcta tttcgccatc ggcgttccct ttgaacaggt gtggctgccc       300
     aggatcgcgg ccgccaaccc ggccatgaaa atcgtccgta cagaccgggg aattgaaaaa       360
     cgcgccatga cacaccacgc ccatgatgac ggacacgcag aagcagctgt cagccacggc       420
     ggtgccgacc cccacatctg gctgtcgccg tccctggtta aacttcaggc cgcaaccatt       480
     gccaacgcgt taaaagaagc agacccggcc catgccgccg actaccaggt ccatgccgat       540
     gcgtttttcg ccgagcttga ggccctggac aaagagttgc ggaacctgtt tgccgatgcc       600
     accggagcgc ggtttctggt gtttcatccg tcgtggggct attttgccga cgcttacggc       660
     cttgtccagg tgcccatgga agttgaagga aaagagccca agccgggcca gttgcgggac       720
     ctgattgagc atgccaggaa aaaccggatt tccgtcatcc tggttgcgcc ccagttttca       780
     tccagaagcg cgcaggtcct ggccgaagag atcagcggca ccgtggccgt ggccgacccg       840
     ctggcggaaa actggccgga caatttacgg accgtggccc gcaccattcg gggggcagta       900
     aaccgatga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page