(data stored in ACNUC7421 zone)

EMBL: CP000859.PE401

CP000859.PE401       Location/Qualifiers
FT   CDS_pept        462093..462866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0401"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dps:DP3061 related to Mn/Zn ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66211"
FT                   /db_xref="GOA:A8ZT47"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT47"
FT                   /protein_id="ABW66211.1"
FT                   /translation="MTAIVDMHNVSFTYGGPAVIENVTLSVSEGEFVALIGPNGGGKTT
FT                   LLKLMLGLVKPQKGTVRVLGRPPEKASHHIGYVPQDIHLNLAFPVTALDVVLMGKLAPG
FT                   KRWIGRPARHKTDALAALAQMGMEASAHTRIGELSGGQRQRVFIARALVTQPKLLLLDE
FT                   PTASIDTRGQADFLELLHDLNQQVTIVMVSHDLLAISHHVTSVACVNRGLHYHRRSELA
FT                   GSLINTSCPCTVESLCPVEMVARETPHLFIRNRKP"
     atgaccgcca tcgtggatat gcacaacgtt tcatttacct atggcggtcc ggccgtgata        60
     gaaaacgtca ccctgtccgt atccgaaggg gagttcgtgg ccctgatcgg gcccaacggc       120
     gggggcaaga ccacgctgct caagctgatg ctgggcctgg tcaaaccgca aaaaggaacc       180
     gttcgggtgc tgggccggcc ccctgaaaag gcatcccacc atatcggata cgtgccccag       240
     gacattcact taaaccttgc attccccgtc actgccctgg acgtggtgct gatgggaaag       300
     cttgcacccg gcaaacggtg gatcggccga ccggcccgtc acaaaaccga cgccctggcc       360
     gccctggcgc agatgggcat ggaggccagc gcgcataccc gcatcggaga gctttccggg       420
     ggccagcgcc agcgggtttt tatcgcccgg gccctggtca cccaaccgaa actgctgctg       480
     ctggacgaac ccacggccag catcgacacc aggggccagg ccgactttct ggaattgctg       540
     catgatctga atcaacaggt caccatcgtg atggtaagcc acgaccttct ggccatctcg       600
     caccatgtga cctcggtggc ctgcgtcaac cggggccttc actaccaccg ccggtccgaa       660
     ctggccggca gcctgatcaa tacgtcgtgc ccctgcaccg tggagtcgct ctgcccggtg       720
     gagatggtgg caagggaaac cccgcacctt tttattcgaa accggaaacc gtga             774
//

If you have problems or comments...

PBIL Back to PBIL home page