(data stored in ACNUC7421 zone)

EMBL: CP000859.PE402

CP000859.PE402       Location/Qualifiers
FT   CDS_pept        462871..463692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0402"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: transport system permease protein; ABC-3
FT                   protein; KEGG: dps:DP3062 probable Mn/Zn ABC transporter,
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66212"
FT                   /db_xref="GOA:A8ZT48"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT48"
FT                   /protein_id="ABW66212.1"
FT                   /translation="MIEALHYDFMQNALAAGLLAAVICGIMGSLVVVNRIVFLSGGIAH
FT                   AAFGGIGMAFFFGWSFLAGTLGFALVAALIMAGITLRAKHRADTIIGVIWAVGMAIGVV
FT                   LLDLTPGYNVDLMSYLFGSILTVPEKDLWIMAGLGLGISVLVVFFYNDLLAISYDEEFA
FT                   RVRGVAVGPIYFMMIGMLAVSIVMVIQVVGLILVIALLTIPPFIMEKYARSLARMMIGS
FT                   SLLGILFTLAGLWLSYAFDLTSGAAIILVAGAAFFLFLLIEKVRLMARQRL"
     atgatcgagg ccctgcacta cgacttcatg caaaacgccc tggccgccgg cctgctggcc        60
     gccgtgatct gcggcatcat gggctccctg gtggtggtca accgcatcgt gtttctctcc       120
     ggcggcattg cccacgcggc cttcggcggt atcggcatgg cctttttctt cggctggtcc       180
     tttctggccg gcaccctggg gtttgccctg gttgcggccc tgatcatggc cgggatcacc       240
     ctgcgggcca aacaccgggc cgacaccatc atcggcgtga tctgggccgt gggcatggcc       300
     atcggcgtgg tgctcctgga cctgacgccg ggatacaacg tggacctgat gagttacctg       360
     ttcggcagca ttctcacggt gccggaaaag gacctgtgga tcatggcggg tctggggctg       420
     gggatttcgg tgctggtggt tttcttctac aacgaccttc tggccatctc ctatgacgag       480
     gagtttgccc gggtgcgggg cgtggccgtg gggccgatct attttatgat gatcggcatg       540
     ctggcggtct ccatcgtgat ggtgatccag gtggtgggcc tgatcctggt gatcgccctg       600
     ctcaccattc ccccctttat catggaaaaa tacgctcggt ccctggcccg catgatgatc       660
     ggctccagcc tgctgggcat tctcttcacc ctggccgggc tgtggctctc ctacgccttt       720
     gacctgacct cgggcgcggc catcatcctg gtggccggcg ccgccttctt tctcttcctg       780
     ctgatcgaaa aggtccggct gatggcccgg caacggctgt ag                          822
//

If you have problems or comments...

PBIL Back to PBIL home page