(data stored in ACNUC7421 zone)

EMBL: CP000859.PE407

CP000859.PE407       Location/Qualifiers
FT   CDS_pept        complement(467448..469235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0407"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: sun:SUN_1632 Fe-S
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66217"
FT                   /db_xref="GOA:A8ZT53"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZT53"
FT                   /protein_id="ABW66217.1"
FT                   /translation="MFLPATPEEVHALGWEAVDVILVTGDAYIDAPSVGVAVIGRVLSD
FT                   AGYRVGVIAQPDLSGDDIARLGEPALFWGVTGGCVDSMVSNYTATGKKRKSDDLTPGGV
FT                   NNRRPDRAVIAYANLIRRHFKQTRPIVLGGIEASLRRISHYDCWSDSVRRSVLCDAKAD
FT                   FLVFGMGERTVVKLAHALKNNLPTADIRGLCYMSREKPDTCVELPAHEAVAQDKELFAT
FT                   MYAEFYKQSRTPRGKRLCQLQDTRYLVINPPPQPLSTEELDHVYGLAYQRSVHPTDKAA
FT                   GEVRAIETTQFSIVTHRGCFGECSFCAITVHEGPIIMSRSEASILREARQMRDHPDFKG
FT                   TIYNVGGATANMYGAGCGRKKTGGVCAGRQCLWPEICDNLVVDHHRQRRLLEKIGKLAG
FT                   VRHVFVQSGIRHDLVLHDAGGGQRYLEALLTRHISGQMKIAPEHSEPHVLRLMGKPGAD
FT                   VWTRFVREFNTTKKRLSKRVFFTCYFIAAFPGCTLADMRRLGAIVKKTLAFTPEQVQIF
FT                   TPAPSTPATAMYHTEKDQNGNPVFVEKDPAKKEAQKRVLTEAAKEVPPVRPTDRRPSGP
FT                   KKTRPRKGPANRPGSTRGR"
     atgtttttac cggcaacacc ggaagaggtt catgccctgg gatgggaggc ggtagacgtt        60
     atcctggtca ccggggacgc ctatattgac gccccgtcgg tgggcgtggc cgtgatcggc       120
     cgggtgctgt ccgatgccgg ctatcgggtg ggggtgattg cccagcccga cctctctgga       180
     gacgatatcg cccggctggg cgagccggcc ctgttctggg gggtgaccgg cgggtgcgtg       240
     gattccatgg tctccaatta cacggccacg gggaaaaaac ggaaaagcga cgacctgacc       300
     ccgggcgggg tcaacaaccg gcggccggac cgggccgtga tcgcctacgc caacctgatc       360
     cgccgccact tcaagcagac ccggcccatt gtgctgggcg gcatcgaggc cagcctgcgg       420
     cgcatctccc attatgactg ctggagcgat tcggtacgcc ggtccgtgct gtgcgacgcc       480
     aaggccgatt ttctggtctt cggcatgggc gaacgcaccg tggtgaagct ggcccacgcg       540
     ttgaaaaaca acctgcccac agccgacatt cggggcctct gctacatgtc ccgcgaaaaa       600
     ccggacacct gcgtggaact gcccgcccat gaggcggtgg cccaggataa agagctgttt       660
     gccacaatgt atgccgagtt ttacaaacag agccgcacgc cccggggcaa acggctgtgc       720
     cagcttcagg acacccgcta cctggtgatc aacccgcccc ctcagcccct ttccaccgag       780
     gagctggacc atgtgtacgg gcttgcgtat caacgatccg tgcacccgac ggacaaggcg       840
     gcaggcgaag tgcgggcgat tgaaaccaca cagttttcca ttgtcaccca tcgcgggtgc       900
     tttggcgagt gcagcttctg cgccattacg gttcatgaag gcccgattat catgagccga       960
     agcgaggcct ccattctgcg ggaggcccgc cagatgaggg accatccgga ttttaagggc      1020
     accatttata acgtgggcgg ggccacggcc aacatgtacg gcgccgggtg cggccgcaaa      1080
     aaaaccggcg gggtgtgtgc cggccgccag tgtctctggc cggagatctg cgacaacctt      1140
     gtggtggacc accatcggca acggcggctt ttagaaaaga tcggcaagct ggccggtgtg      1200
     cggcatgtgt ttgtgcagtc cggtattcgt cacgacctgg tgctgcatga cgccggcggc      1260
     gggcagcggt acctggaggc cctgctgacc cgtcacatat cgggccagat gaagatcgcg      1320
     ccggagcact cggaacccca tgtgctgcgg ctgatgggca aacccggcgc cgatgtgtgg      1380
     acccggttcg tgcgggagtt caacaccacc aaaaaacggc tgagcaagcg ggtatttttc      1440
     acctgctatt ttatcgcggc ctttcccgga tgcaccctgg ccgacatgcg ccgcctgggc      1500
     gccatcgtca aaaaaaccct ggcctttaca ccggagcagg tccagatatt taccccggcc      1560
     ccttccaccc cggccaccgc catgtaccac acggaaaagg atcagaacgg caatcccgtg      1620
     ttcgtggaaa aagacccggc aaaaaaagag gcacagaaaa gggtgcttac cgaggcggca      1680
     aaggaggtgc cgccagtgcg gccgacagat cgccggccat ccggtccaaa aaagactcgg      1740
     ccgcgcaaag ggcctgccaa tcggccaggt tcgaccagag ggcggtaa                   1788
//

If you have problems or comments...

PBIL Back to PBIL home page