(data stored in ACNUC7421 zone)

EMBL: CP000859.PE408

CP000859.PE408       Location/Qualifiers
FT   CDS_pept        469645..470103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66218"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTF4"
FT                   /protein_id="ABW66218.1"
FT                   /translation="MPEDKKKEKVLHARISQDLEEQIRKEAGSLGVSVSNLVRNILSNT
FT                   FDLVENIVTDSADISRSARRRSASPVDGTRPSGPVAPDPVSESGRVVAWQEAIMNLNAV
FT                   CSQCNTILEKGSRAAIAVVEGTGPRPALCLTCLKEITHEDQNRSDNNE"
     atgcccgaag acaagaaaaa agagaaggta cttcacgcgc gcatcagcca ggacctggaa        60
     gagcagattc gaaaagaggc cgggtccctg ggggtctcgg tatccaacct ggtgcgcaac       120
     attctttcca acacctttga cctggtggaa aacatcgtca cagacagcgc cgacatctcc       180
     cggtccgcgc gcaggcggtc agcgtcgccg gtcgacggaa ccagaccctc cggcccggtt       240
     gcgcccgatc cggtttcaga atcgggccgc gtggtggcat ggcaggaagc cattatgaac       300
     ctcaacgcgg tctgctcgca atgcaacacc atcctggaaa agggaagccg cgccgccatt       360
     gcggttgtcg aaggcaccgg tccgcgtccc gccctttgtt taacctgcct caaggagatc       420
     acccatgaag accagaaccg ttcggataat aatgaataa                              459
//

If you have problems or comments...

PBIL Back to PBIL home page