(data stored in ACNUC7421 zone)

EMBL: CP000859.PE414

CP000859.PE414       Location/Qualifiers
FT   CDS_pept        476184..477779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0414"
FT                   /product="peptide chain release factor 3"
FT                   /note="TIGRFAM: peptide chain release factor 3; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein; KEGG:
FT                   pca:Pcar_0583 probable peptide chain release factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66224"
FT                   /db_xref="GOA:A8ZTG0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTG0"
FT                   /protein_id="ABW66224.1"
FT                   /translation="MKTENKISQRQINRRRTFGIISHPDAGKTTLTEKLLLFGGAIQMA
FT                   GAVKARKAGRHATSDWMAIEQERGISVTSSVMKFDYRDYEINLLDTPGHQDFSEDTYRV
FT                   LTAVDSAVMVIDSVKGVETQTRKLMEVCRMRNTPILTFVNKLDREGLSPIDILGDIEDK
FT                   LQIECAPLSWPIGMGKRFKGTYNLHRGELVLFTPGQERLTGDTVTIQNLDDPLLDQVLG
FT                   SQADQLREDVALLEGAATPFDLDYFLKGGQTPVFFGSAINNFGVRELLDTFVEIAPGPQ
FT                   PRAAVTRTVTPDEPAFSGFVFKIQANMDPAHRDRIAFLRVCSGRFVRGMRVRHHRIGKE
FT                   IQIANPIIFMAQDRAFVEEAWPGDIIGIHNHGTIRIGDTFSEKEPLAFTGVPNFAPELF
FT                   RRVILRSPLKAKQLQKGIDQLVEEGAIQVFRPLANNAIILGAVGVLQFEVTMARLKAEY
FT                   GVDAVYEPVDYSVARWVHCDDRKLLSLFEKDRQANLARDAEGNLTYLAQNEWQFNYMAE
FT                   KWPDIGFSKTRECQ"
     atgaaaactg aaaataaaat ttctcagcgg cagatcaacc ggcgccgcac cttcggcatt        60
     atcagccatc ccgacgccgg caaaaccacc ctgaccgaaa agctgctgct gttcggcggc       120
     gccattcaga tggccggcgc ggtcaaggcc cgcaaggccg gccgccacgc caccagcgac       180
     tggatggcca ttgagcagga gcgcggcatc tcagtgacca gctcggtgat gaagttcgac       240
     taccgcgact acgagatcaa cctgctggac actcccggcc accaggactt ttccgaagac       300
     acctaccggg tgctcaccgc cgtggacagc gcggtgatgg tgatcgacag cgtcaagggc       360
     gtggagaccc agacccgcaa gctgatggag gtgtgccgga tgcgcaacac ccccattctc       420
     acctttgtca acaagctgga ccgggagggc ctgtcgccca tcgatattct gggcgatatc       480
     gaagacaaac tccagatcga gtgcgcgccc ctctcctggc ccatcggcat gggcaaacgg       540
     ttcaagggaa cctacaacct tcatcgcggc gagctggtcc tgtttacccc cggccaggag       600
     cgcctgaccg gcgatacggt gaccattcaa aatctggacg atcccctgct ggaccaggtc       660
     ctgggcagcc aggccgacca gttgcgcgaa gacgtggccc tgctggaagg cgcggccacc       720
     ccctttgacc tggactattt tttaaaaggg ggccagaccc cggtcttttt cggcagcgcc       780
     atcaacaact tcggtgtgcg cgagcttctg gacacctttg tggagatcgc ccccggcccc       840
     cagccccggg ccgccgttac ccgcaccgtg acaccggatg agccggcctt ttccgggttt       900
     gtgtttaaaa ttcaggccaa catggacccg gcccaccggg accggatcgc ctttctgcgg       960
     gtctgctcgg gccggtttgt gcggggcatg cgggtgcgcc accaccgcat cggcaaggag      1020
     attcagatcg ccaaccccat catcttcatg gcccaggacc gggcctttgt ggaagaggca      1080
     tggccgggcg acatcatcgg cattcacaac cacggcacca ttcgcatcgg cgacaccttt      1140
     tcggaaaaag agcccctggc ctttaccggg gtccccaatt tcgcgcccga gctttttcgc      1200
     cgggtgatat tgcggtcgcc cttaaaggca aaacagcttc agaaaggtat tgatcagctg      1260
     gtggaggagg gggccattca ggtgttccgg cccctggcga acaacgccat cattctgggg      1320
     gccgtgggcg tcttgcagtt cgaggtgacc atggcccggc tcaaggccga atacggggtg      1380
     gatgccgttt acgagccggt ggattacagc gtggcccgct gggtccactg cgatgaccgc      1440
     aagctgctgt cgctgtttga aaaggaccgc caggccaacc tggcccgcga cgccgagggc      1500
     aacctcacct acctggccca gaacgaatgg cagttcaact acatggcgga aaagtggccg      1560
     gacatcgggt tttcaaaaac ccgggagtgc cagtag                                1596
//

If you have problems or comments...

PBIL Back to PBIL home page