(data stored in ACNUC7421 zone)

EMBL: CP000859.PE42

CP000859.PE42        Location/Qualifiers
FT   CDS_pept        complement(50587..51408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0042"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="KEGG: sat:SYN_00420 pantoate--beta-alanine ligase;
FT                   TIGRFAM: pantoate--beta-alanine ligase;
FT                   cytidyltransferase-related domain; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65852"
FT                   /db_xref="GOA:A8ZRT5"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRT5"
FT                   /protein_id="ABW65852.1"
FT                   /translation="MQAHSDRMRRQGKTIAFVPTMGFLHEGHLSLLETGKAHGDHLVLS
FT                   IFVNPTQFAAGEDFASYPKSFEKDAQAAENQGVDVLFAPEATGLYEPGYETYVSLESLP
FT                   NHLCGIFRPAHFRGVATVVAKLFNIVKPHVAIFGEKDFQQLAVIRRMARDMNFDIKIMG
FT                   APIVREPDGLAMSSRNTYLKPEQRPAALSLYKSLVLARQMVAAGETGAAAIIEAARNLI
FT                   AGFSDTAIDYVAICDPDTLDDMDSLDRPALMALAVRVGTCRLIDNMMLVRP"
     atgcaggccc attcagaccg catgcgcagg cagggcaaaa ccatcgcctt tgttcccacc        60
     atgggctttc ttcatgaggg acatctgtcc ctgcttgaaa ccggcaaggc ccacggggac       120
     catctggtgc tcagcatttt tgtcaacccc acccagtttg ccgcgggcga ggattttgcg       180
     tcctatccaa aaagctttga gaaagacgcc caggccgcgg aaaaccaggg cgtggacgtt       240
     cttttcgcgc cggaagcaac cggtctttac gagccggggt atgagaccta tgtgtcgctg       300
     gagtcccttc ccaaccacct gtgcggtata ttccggcccg cccattttcg gggggtggcc       360
     acggtcgtgg ccaagctgtt taatatcgtc aaaccccatg tggccatctt cggggaaaag       420
     gattttcagc agctggccgt gatccggcgc atggcccggg acatgaactt tgacataaag       480
     attatgggcg ctcctattgt gcgggaaccc gacggccttg ccatgagttc ccgcaacacc       540
     tatcttaaac cggaacagcg gccggcggcc ctttcccttt ataagtccct ggttctggcc       600
     cggcagatgg ttgccgccgg tgaaacaggg gcggccgcca tcatcgaagc ggcccggaac       660
     ctgatagcag gtttttccga caccgccatt gattatgtgg ccatctgtga tccggacacc       720
     ctggacgaca tggacagtct cgaccggccg gccctcatgg ccctggccgt gcgcgtgggc       780
     acctgccggc tgattgataa catgatgctg gtccggccct ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page