(data stored in ACNUC7421 zone)

EMBL: CP000859.PE421

CP000859.PE421       Location/Qualifiers
FT   CDS_pept        complement(484267..486432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0421"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: mta:Moth_2203 heavy
FT                   metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66231"
FT                   /db_xref="GOA:A8ZTG7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTG7"
FT                   /protein_id="ABW66231.1"
FT                   /translation="METVQEKRFRVQNLDCAACAAKIERELQNTEGVEAAVVDFANLTL
FT                   HLRAADISKALAAVARIEPDVKIESTLQDSEGDAHESTEAGNFRKQVGIIVIAGIIFAI
FT                   HLFFEDQLHQRPWAWVEYPIVIAAYLLAGWSVLIGALRTLRRGQFFDENVLMVIATTGA
FT                   MAIHALSEAVGVMLFFKVGELLQDMAVSKSRRSVRGLLAARPNRALLKTEGGLKETSPE
FT                   KVKVGEIILVKPGEKVALDGTVIEGVSQVDTSPLTGEPVPVQTRPGDTVLAGSINTASA
FT                   LTVRVTKPFEASSIARVLELVESAAARKAATEKFITTFARYYTPVVVAIAAAIALVPPL
FT                   LINDAQFSTWIYRALVLLVISCPCALVVSIPLGYFGGIGRASRSGILIKGSMFIDALSK
FT                   VKTVVFDKTGTLTRGVFTVDRVVTDNGFSSDQVLQMAAAVELHSDHPIGKSIVEAMTSK
FT                   GLAIDESLVSNHVAISGKGVKAVFDGKSIAVGNDALLHERQIDHGKCDFDSTVAHVVVD
FT                   NQYAGHILIGDQLKPDAKLAMERLRSDGVSKLVMLTGDNACAAASVAKALNLDQFHAEL
FT                   LPEDKVRIFEQILAETKEDGKVAFVGDGINDAPVLARADVGVAMGALGSDAAIETADVV
FT                   LMTDAPAKMADAVSIAKNTRKIVLQNIVLALTVKGIFILFGSFGLATMWEAVFADMGTA
FT                   LLALLNATRAFRGYPSLKEVHVKNASV"
     atggaaactg ttcaggaaaa gagatttcgc gttcaaaatc ttgactgcgc cgcctgcgcg        60
     gccaagatag agagggaact gcagaatacc gaaggggtgg aagcggcggt tgttgatttt       120
     gccaacctca ccctacactt gagggcggcc gatatctcga aggctctggc agcggttgcg       180
     cgcattgaac ccgacgtcaa gatcgagtcc accttgcagg actcggaagg ggatgcccat       240
     gaatcaacgg aggcgggcaa ttttcgaaag caagttggaa tcatcgtcat cgctggtatt       300
     atcttcgcaa ttcacctgtt ttttgaagac caattgcacc agcggccgtg ggcgtgggtg       360
     gaatatccca tcgtgattgc cgcttacctg ctggccggct ggagcgtttt aatcggtgcg       420
     ctgcgaacgc tgcggcgagg gcagtttttt gatgagaatg tgcttatggt catcgccacg       480
     accggtgcca tggccataca cgccctgtcc gaggcagtcg gtgtgatgct gtttttcaag       540
     gttggcgaac tcctgcagga catggcagtt tccaaatcac ggcgttcggt tcgcgggctg       600
     ctggctgcca ggccgaaccg ggccttgctt aagactgagg gtggtctaaa ggaaacctct       660
     cccgaaaagg tcaaggtggg cgaaatcatc ctggtcaagc ccggcgagaa agtcgctttg       720
     gacggtacgg tgattgaagg agtctcgcag gtggacacct cgcctttgac tggcgaaccg       780
     gttccggttc aaacgcgccc gggcgatacc gtcctggccg gcagcatcaa cacggcatcg       840
     gcgctgacgg ttcgggtcac aaagcctttt gaagcgtctt cgattgcacg ggtattggag       900
     ttggttgaaa gtgcggccgc gcgcaaggcc gccactgaaa agtttatcac cacctttgcc       960
     cgttattata cgccggtggt ggtggccatt gcggcggcta tcgccctggt tccgcctctg      1020
     ctcataaatg acgcccaatt ctcgacctgg atctatcgcg ccttggtgtt gctggtgatc      1080
     tcgtgcccct gtgctctggt agtcagcatc cccttgggtt atttcggtgg aatcggccgg      1140
     gcctcgcgca gtggaatcct gatcaaggga tcaatgttca tcgatgccct ttcaaaagtc      1200
     aaaacagtgg tttttgacaa gaccggcact ttgacacgcg gcgtttttac ggtggatcgt      1260
     gtcgttaccg acaacggatt ttcgtcggac caggtactgc aaatggccgc agccgtggaa      1320
     ctgcactccg atcatcccat tggcaagtcc atcgtagagg cgatgacgag taaaggtctt      1380
     gccattgatg aatcgctggt gagcaatcac gtcgccattt ccggaaaggg ggtcaaggct      1440
     gtctttgacg ggaaaagcat cgccgtcggt aacgatgcgc ttttgcatga aagacagatc      1500
     gatcatggaa aatgtgactt tgacagcacc gttgcccatg tagtggtgga taatcaatat      1560
     gccggtcaca tcttaatcgg tgaccaactc aaaccggatg ccaagctggc aatggagcgg      1620
     ctgcgatcag atggggtttc gaaacttgtg atgttgacgg gcgacaacgc gtgcgcagct      1680
     gcaagcgttg ccaaggctct caatctggat caatttcatg ccgaattgct gccggaagac      1740
     aaggtccgca ttttcgaaca aatcctcgcg gaaaccaaag aggacggaaa ggtcgccttt      1800
     gtgggagatg gtatcaacga tgcgccggtc ttggcccggg cagatgtggg ggtggccatg      1860
     ggtgccctcg gttcagacgc cgccatcgaa accgccgatg tggtgctgat gaccgacgct      1920
     ccggcaaaaa tggccgatgc cgtcagcatc gctaagaaca cccgaaagat tgttttgcag      1980
     aatattgtgc tggcactgac cgttaaaggg atattcatat tgttcgggtc ctttggtttg      2040
     gctaccatgt gggaggccgt ttttgctgat atgggtactg ccctgctcgc actgctcaac      2100
     gcgacgcgag cgtttcgtgg atatccttcc ctcaaggaag tccacgttaa aaacgcttcc      2160
     gtctga                                                                 2166
//

If you have problems or comments...

PBIL Back to PBIL home page