(data stored in ACNUC7421 zone)

EMBL: CP000859.PE423

CP000859.PE423       Location/Qualifiers
FT   CDS_pept        complement(487247..489253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0423"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG:
FT                   rxy:Rxyl_2282 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66233"
FT                   /db_xref="GOA:A8ZTG9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTG9"
FT                   /protein_id="ABW66233.1"
FT                   /translation="MELKAHDMTTTCKTTLKVGDVLNNRWVILGFIDKGGMGEVYRAHQ
FT                   TNLNRDVAIKVVSREWLESIDEGDEEAETLVQRFRREVQAMAQIRHPNILQVFDHDAIT
FT                   VKKGDQDKSMEYIAMEYIPGGSLRDTMSDEGFYPEEDLIKTWVRRYFLPVLAGVMALHE
FT                   NGIVHRDLKPENIFMDQDTPKIADFGLARSSRLKPVTQSMDVKGSPHYMSPEHFFDFKR
FT                   ADQCADVYSLGKMLFEAVEGKITSVTTPFKRAKLAKAESPFFQELDRIIQMATAESRDE
FT                   RTESVRDLLGQLERVIHGLASQKPGAKFPWQQSASLFSKPRWVWTGIIVAVLSVISMAA
FT                   WHFMGEPGLGPPKGSLSTSPSQHQTQTVPGNETTARPADAEKDSFASEHLGKQHLIQGG
FT                   PFSIPAVLDGSSDQSIQVEPFYVDEFFVTNQQFVDFLNHNLSQISIESGVVKGSGANWF
FT                   LMGEVRAGYEPIVYRSNEFHVSDPAYASSPALRVTGYGASAFANYFGRRLPTEVEMLFA
FT                   MVKGEDGSKVNAEPSAEVNTQPMGGMMRMMGDWQGETENWSSVSPDPSPSAKDQAEPKR
FT                   SDFLLSAASFSPNLLGIKGLNHEIGEWVYTEGLVQPSANASTTNRYAVIGGVEGAPKDK
FT                   NSLPAVVVRFPWEGFEEIGFRTVKSAVVSNSAG"
     gtggaactga aagcacatga tatgacaacg acatgtaaaa ccacgctgaa agtcggcgat        60
     gtgctcaaca atagatgggt catcctcggc tttattgaca agggcggaat gggcgaggtc       120
     tatcgtgcgc atcaaaccaa tctgaatcgc gatgtcgcaa tcaaggtcgt ttcacgggaa       180
     tggcttgaat ccattgacga gggagacgaa gaggccgaaa ccttggtcca acggttcagg       240
     cgggaagtcc aggccatggc ccagattcgg cacccgaata ttttgcaggt tttcgatcac       300
     gatgccatca ccgtaaaaaa gggcgatcag gacaagtcca tggagtacat cgccatggaa       360
     tacatccccg gcgggtctct tagagacacc atgtccgatg aaggattcta cccggaagag       420
     gatcttatca aaacgtgggt gaggcggtat tttttacctg tgctggcggg tgtaatggca       480
     ttgcacgaaa acggcatcgt gcaccgtgat ctcaagcctg aaaatatttt catggaccag       540
     gacacgccca aaatcgccga tttcggcctg gcgcgttcga gccgactgaa accggtcacc       600
     cagtccatgg acgtaaaagg ttcgcctcat tacatgtctc cggaacattt tttcgatttc       660
     aaaagggctg atcagtgcgc tgatgtctat tctttgggca aaatgctttt tgaagcggtt       720
     gaaggaaaga tcacgtccgt aacgacgccg tttaaaaggg caaagcttgc caaagccgaa       780
     tccccctttt ttcaagagtt ggaccgaatt attcaaatgg ctacggccga gagcagagac       840
     gagcgaaccg aatccgtgcg ggacttgctc ggacagcttg aacgcgtaat ccatgggttg       900
     gcgtctcaga agccgggtgc gaaatttcca tggcaacaat cggcctccct gttctcgaaa       960
     ccgagatggg tatggacagg tatcattgtt gcggtgctgt cggtcatatc gatggccgcc      1020
     tggcatttta tgggtgaacc cggtttgggt ccaccgaagg gtagtctttc gacatccccc      1080
     agccagcacc aaacccagac ggtccctggt aacgagacca ccgcaagacc ggcggacgcc      1140
     gaaaaggatt ctttcgcgtc tgagcacctt ggaaaacagc acctcatcca agggggacca      1200
     ttttcgatcc ctgcggtatt ggatgggagc agcgatcaat cgatccaggt cgaaccgttt      1260
     tacgtggacg agtttttcgt taccaaccag cagttcgtcg attttttgaa tcacaacctt      1320
     tcacaaatca gcatagaaag cggtgtggtg aaaggcagtg gtgcaaactg gttcttgatg      1380
     ggagaggtgc gcgcgggata cgagccgatc gtctaccgaa gcaatgaatt tcatgtcagt      1440
     gatccggcct atgcctctag tcctgctttg cgcgttaccg gttatggcgc ttcggccttt      1500
     gcaaactact tcggcagacg attgccgacg gaggtggaaa tgctctttgc aatggttaag      1560
     ggcgaggacg gatcgaaagt gaatgcagag ccctcagcgg aagtgaatac ccagccgatg      1620
     gggggcatga tgcgtatgat gggagactgg cagggcgaaa cggaaaactg gagtagcgtt      1680
     tctcctgatc cgagtccgag cgccaaagac caagcggaac caaagcgttc cgattttctg      1740
     ttatcagccg catctttttc tccgaacctg ttgggcataa aggggctcaa ccatgagatc      1800
     ggcgaatggg tttatacaga gggactggtc cagccatcgg cgaacgcctc gacaacaaat      1860
     cgctatgcgg ttatcggtgg cgttgagggg gctccgaagg ataaaaattc tttacccgcg      1920
     gtcgttgtgc gtttcccctg ggaaggattc gaggaaattg gtttcaggac tgtaaagagc      1980
     gccgttgtca gcaattcggc gggatga                                          2007
//

If you have problems or comments...

PBIL Back to PBIL home page