(data stored in ACNUC7421 zone)

EMBL: CP000859.PE424

CP000859.PE424       Location/Qualifiers
FT   CDS_pept        complement(489253..489558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66234"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTH0"
FT                   /protein_id="ABW66234.1"
FT                   /translation="MELGEKRKDVEIKSERPDEKDPLTKYFDGMGTATARIIIKRHLDD
FT                   DQWEKYGLKDLKNTGRYYIARLVEKDGTVIDEVLIDKQSGTIQSLRGRIGAEGQLR"
     gtggaacttg gagaaaagag aaaagacgtt gaaattaaat cggagagacc agatgagaaa        60
     gatcccctga caaaatattt tgacggcatg ggaaccgcca ctgccagaat cataatcaaa       120
     cggcatcttg acgacgatca atgggaaaaa tacggcctga aagatctgaa aaacaccggc       180
     cgatattaca ttgcccggct tgttgaaaag gacggcaccg tcattgatga ggtcttgatc       240
     gacaaacagt ccggaacgat tcagtcgctg agagggcgaa tcggtgccga gggacaacta       300
     cgatag                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page