(data stored in ACNUC7421 zone)

EMBL: CP000859.PE427

CP000859.PE427       Location/Qualifiers
FT   CDS_pept        492516..493892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0427"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   ypi:YpsIP31758_2820 transcriptional regulatory protein
FT                   ZraR"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66237"
FT                   /db_xref="GOA:A8ZTH3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTH3"
FT                   /protein_id="ABW66237.1"
FT                   /translation="MTIQNPSHILIVDDDLNHLKTLQTIVRSWGYQVSTADDGVKAVDT
FT                   VKERPFALILMDVRMAQMSGIEALKQIKQYNPAIPILIMTAYSSVDSAVEALKSGAYDY
FT                   LTKPLDFEVLKISLARALEHSGLKAENATLKSKMSADYELENIIGRSRPMKELVDMMSM
FT                   VAPSEATVLITGESGTGKELIAKSIHHNSQRKDRALVVVNCAALTETLLESELFGHEKG
FT                   AFTGADKRREGRFKQADKGTIFLDEIGETSAAMQAKLLRVIQEREIQRVGGEETLSVDV
FT                   RILAATNRNLEEDVKNGKFREDLFYRLNVVTLRIPPLRERQDDTPLLAQHFLEKYAKKN
FT                   HKQVKGFSPLAMDMLLKYAWPGNVRELENVIERAVILLPDEHITEKELPVTITSSYAEK
FT                   SEWVAPPPPVAANRPLEEVEKEAILATLDDSGGNKSETARRLGINRKTLHKKLKDYGID
FT                   "
     atgaccatac aaaacccttc tcacattctg attgtcgacg acgatctgaa ccacttgaaa        60
     acgcttcaaa ccatcgtcag aagttggggc taccaggtgt ccacggccga cgatggggtc       120
     aaggccgttg acaccgtcaa agaaagaccg ttcgccctga tcttgatgga tgtgcgcatg       180
     gctcagatga gcggcatcga ggccctgaag caaattaaac agtacaatcc ggccatcccg       240
     attctcatca tgaccgcata ctcttcggtt gattcggcgg tagaggcctt aaaatccggg       300
     gcttacgatt atttgaccaa acccctggac tttgaagtgc tcaaaatcag cctagcgcgt       360
     gctttggagc attccggcct caaggcggaa aatgcaacct taaaatcaaa gatgagcgca       420
     gattacgagc tggaaaatat catcggaaga agccggccga tgaaggaact ggtcgacatg       480
     atgtccatgg ttgcgccttc ggaggcaacc gtgctgatca ccggggaaag cgggaccggc       540
     aaagagctga tcgccaaatc catccatcac aacagccagc gcaaggatcg cgccctggtg       600
     gtggtcaatt gcgcggcact tacagagaca ttactggagt cggagctgtt cggccatgaa       660
     aaaggtgcgt ttaccggtgc cgataaacgc cgcgagggca gattcaagca ggctgacaag       720
     ggaaccattt ttctggatga gatcggcgaa acctccgccg cgatgcaggc caagctgctg       780
     cgggtcattc aagagcggga aatccagcgg gtcggcgggg aagaaacgtt gagcgtggat       840
     gtgcggattc ttgccgcgac caaccgaaac ctggaggagg atgtgaaaaa cggaaaattc       900
     cgtgaagacc ttttctatag actgaacgtc gtcacgctgc gcatcccgcc gctgcgcgag       960
     cgtcaagatg atactccttt acttgcccag catttcttgg agaagtacgc gaaaaaaaat      1020
     cacaagcagg tcaaaggctt ttctccgttg gcaatggata tgctgctaaa atacgcttgg      1080
     cccggcaatg tcagggaact tgaaaacgtc attgagcgtg ccgtgattct cctgccggat      1140
     gaacacatca cagagaaaga gctgcctgtc accatcacct caagttatgc cgaaaaaagc      1200
     gaatgggtgg ctccgccccc accggttgca gccaatcgcc ccctggaaga agttgaaaag      1260
     gaggccattt tggccacact tgatgacagt ggcgggaata aaagcgaaac cgcacgcagg      1320
     ctcggaatca accgcaaaac ccttcacaag aaactcaaag attatggaat agattga         1377
//

If you have problems or comments...

PBIL Back to PBIL home page