(data stored in ACNUC7421 zone)

EMBL: CP000859.PE429

CP000859.PE429       Location/Qualifiers
FT   CDS_pept        494943..495416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0429"
FT                   /product="zinc-resistance associated protein"
FT                   /note="KEGG: stm:STM4172 zinc-resistance associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66239"
FT                   /db_xref="InterPro:IPR025961"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTH5"
FT                   /protein_id="ABW66239.1"
FT                   /translation="MKRNTKGIMTLAVLAVFGFSTLAFAGWGDGYGHMMGPGMMGPGWQ
FT                   QGSGYYGNLSADEIAKLEQQRAEFFRATENTRQQLYEKNLALQSELAKENPDTAKASKL
FT                   QGEISKLQSDLDQKRLEYDIQARKSAPNYNRGYRGGYGSMMGYGPRGGGYCGW"
     atgaaacgaa ataccaaagg gattatgacg ctggccgtat tggccgtgtt tggattctcg        60
     accctcgcgt ttgccggttg gggcgatgga tacggccaca tgatgggacc gggtatgatg       120
     ggaccgggct ggcagcaggg aagtggctat tacggaaatc tttccgcaga tgaaatcgcg       180
     aaactggaac agcagcgcgc agaattcttc cgggcgacgg aaaataccag gcaacagctg       240
     tatgagaaga atctggctct gcaaagcgaa ctggctaaag aaaatccgga caccgccaag       300
     gcatcaaagc ttcagggcga aatttccaag ctgcaaagcg atcttgatca aaaacgattg       360
     gagtatgata tccaggcccg caaatcagca cccaactaca accgcggcta tagaggagga       420
     tatggttcga tgatgggtta cggcccccgc ggtggcggat attgtgggtg gtaa             474
//

If you have problems or comments...

PBIL Back to PBIL home page