(data stored in ACNUC7421 zone)

EMBL: CP000859.PE430

CP000859.PE430       Location/Qualifiers
FT   CDS_pept        495853..496218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0430"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mac:MA1327 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66240"
FT                   /db_xref="GOA:A8ZTH6"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTH6"
FT                   /protein_id="ABW66240.1"
FT                   /translation="MIIKYVYNKVLMGLLAIWSLNNFMLSPAFAQSGGYRNWHMGRWMM
FT                   GDWGMGWFGMIFMLLFWVLVIVGIVFLIRWLVQNTGSRGSSGVGTGSQAMDILKERYAK
FT                   GEITHDEFESMKKEILR"
     atgatcatta aatatgttta taacaaagtg ttgatggggc ttctcgcgat atggagtctg        60
     aacaatttta tgttaagtcc cgcattcgcc caatccggcg ggtaccgaaa ctggcacatg       120
     gggcgatgga tgatgggcga ctggggaatg gggtggttcg gtatgatatt catgttactt       180
     ttttgggttt tagtcatcgt cggaatcgtt tttctgattc gctggctggt tcaaaacacg       240
     ggcagcagag gctcatccgg tgtcggcaca ggttctcagg caatggatat tttaaaggaa       300
     cgctatgcca aaggagaaat cacccacgat gaatttgagt ccatgaaaaa agagatcctt       360
     agatag                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page