(data stored in ACNUC7421 zone)

EMBL: CP000859.PE435

CP000859.PE435       Location/Qualifiers
FT   CDS_pept        502435..503460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0435"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_3781 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66245"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTI1"
FT                   /protein_id="ABW66245.1"
FT                   /translation="MGIAPLVEWQQHLDGWPGFSVFRKRHLQLTKSQATAVECRTDCGL
FT                   GCPRNVVTHAPNDIVAVCPEQEEKPYPLKQQDTLIYSVKRASLHKDICSALGITHRESK
FT                   VDGCRRTWRLGDFVPTAGLVFPVFLTQQENQDELLEIVKNLCLLHADPFVLLTPTRRRL
FT                   SPPVEQMLAQRKAVFLALEEEMPFDEQSDLQVRRTPDELFAAFHEDVPEPGSGGMVHFP
FT                   TPDGIRWSDIKIQFRNGHTVTIWAGGQSGRYTYYQMGMYSKKNGDRTVQWKLLEAFAAS
FT                   RGEIDWSNQAANNKLKKQKQELSKCLREFFRLQEDPIEWVKGEKCYRCRFRILPEGDEN
FT                   Y"
     ttgggaatag ctcccctggt cgagtggcaa cagcatcttg acgggtggcc gggattttcg        60
     gttttccgga aacgccacct tcaactgacc aaaagtcagg ccacggccgt ggagtgccga       120
     accgattgcg gtctgggatg cccgcgcaat gttgtaacgc acgctcccaa tgacatcgtg       180
     gcggtctgcc cggagcagga agagaaaccg tatccgctca agcagcagga cactctcatc       240
     tattcggtga agcgagcatc cctgcacaag gatatctgtt cggcgttggg aatcacgcac       300
     cgggaaagca aggttgacgg ttgccggcgc acatggcggt tgggtgattt tgtgcccacg       360
     gctggattgg tttttccagt attcttgact caacaggaaa accaggacga actgcttgag       420
     atcgtgaaaa atctttgcct gctacatgcc gatccctttg tgctcctgac cccgacccgg       480
     cgacggttat cccctccagt cgaacagatg ctggcccaac gcaaggccgt cttcctggca       540
     cttgaagaag agatgccgtt cgacgagcag agcgaccttc aagtacggcg aactcccgac       600
     gagctgtttg ccgcgtttca cgaggatgtt ccggagcctg gttccggtgg catggtgcat       660
     tttccgacgc ctgacgggat aagatggtct gacatcaaaa tccagttcag gaatggacac       720
     acggttacga tttgggccgg tggccaaagc gggaggtaca cctactacca aatgggcatg       780
     tacagcaaga agaatggtga ccgcaccgta cagtggaaac tcctggaagc gtttgctgcc       840
     tccaggggcg aaatcgattg gagcaaccag gctgcaaata ataaattgaa gaagcagaag       900
     caggaactgt ccaagtgctt acgggaattt ttccggctcc aagaggaccc catcgagtgg       960
     gtcaagggcg aaaagtgtta tcgctgccgc tttcgaatcc tgcccgaagg tgatgaaaat      1020
     tattga                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page