(data stored in ACNUC7421 zone)

EMBL: CP000859.PE437

CP000859.PE437       Location/Qualifiers
FT   CDS_pept        complement(505177..505959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0437"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   cte:CT0872 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66247"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTI3"
FT                   /protein_id="ABW66247.1"
FT                   /translation="MKPVAPDRIDALPGKRLSESDTFNFACHDGLACFNQCCRNLNLFL
FT                   YPYDVLRLKKALNITAGDFIERYVDVVMRPDNFFPDVLLSMADNAEKTCPFLTDTGCAV
FT                   YEDRSYSCRLFPMEQGVIMPDGEAKPEILYLFRPPEFCLGRHEDRPLSPAQWIADQQAE
FT                   TYVRMTRLWAEVKALFSADPWGAAGPYGPAAKMAFMAAYNMDAFRDFVFNSGFLKRYKV
FT                   KSATLQKLRASDTELMLFGFDWIKLFVWGIKSDRIRLK"
     atgaaacccg tggccccgga ccggatcgac gccctgcccg gaaagcggct ctccgaatcc        60
     gacaccttca attttgcctg ccatgacggc cttgcctgtt ttaatcagtg ctgccgcaac       120
     ctcaacctct ttctctaccc ctatgacgtg ctgcggctga aaaaggcttt aaacatcacg       180
     gccggcgact ttatcgaacg ttacgtggat gtggtgatgc ggccggacaa cttttttccg       240
     gatgtgctgc tctccatggc cgacaatgcg gaaaagacct gcccgtttct tacggatacc       300
     gggtgcgcgg tgtacgaaga ccgctcctac tcctgccgcc tctttcccat ggagcagggc       360
     gtgatcatgc ccgacggcga ggccaaaccg gagattctct atttgttcag gcccccggag       420
     ttctgcctgg gccgccacga agaccggccc ctgtccccgg cccagtggat cgccgaccag       480
     caggccgaaa cctacgtgcg catgacccgg ctctgggccg aggtcaaggc cctgttttcc       540
     gccgacccct ggggcgcggc cggcccttac ggccctgcgg caaaaatggc ctttatggcc       600
     gcttacaaca tggacgcctt tcgggacttt gtctttaaca gcgggtttct caaacgctac       660
     aaggtcaaat ccgcgaccct gcagaagctg cgggccagcg acaccgagct gatgcttttc       720
     gggtttgact ggatcaagct ctttgtctgg ggcatcaaaa gcgaccggat tcggttaaag       780
     tag                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page