(data stored in ACNUC7421 zone)

EMBL: CP000859.PE44

CP000859.PE44        Location/Qualifiers
FT   CDS_pept        54260..54673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0044"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: aeh:Mlg_2746 single-strand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65854"
FT                   /db_xref="GOA:A8ZRT7"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRT7"
FT                   /protein_id="ABW65854.1"
FT                   /translation="MAGVNKAIIVGRLGRDPELRYTQDGRAVASFSVATSEEWKDKDSG
FT                   DKKERTEWHRVVAFGRLGEICGEYLAKGRLVYVDGRLQTRSWEKDGVTRYTTEIVAANM
FT                   QILEPKGSGGSGGGGSMGEPVADDAGIPDDIPF"
     atggcaggcg taaacaaggc gattatcgtt ggaagactgg gaagagaccc ggaattgcgc        60
     tacacacagg acggacgggc cgtggccagt ttcagcgtgg ccacatccga agagtggaaa       120
     gacaaggatt ccggcgacaa aaaagaacgc accgagtggc accgggtcgt ggccttcggc       180
     cggctcggtg agatctgcgg cgaatacctg gccaagggcc ggctggtcta tgtggatgga       240
     cggcttcaga cccggtcctg ggaaaaggac ggggtcacgc gctataccac ggagatcgtg       300
     gctgccaaca tgcagattct cgaacccaag ggcagcggcg gctccggtgg cggcggctcc       360
     atgggcgagc cggttgccga tgatgcgggc attcccgacg acatcccctt ctaa             414
//

If you have problems or comments...

PBIL Back to PBIL home page