(data stored in ACNUC7421 zone)

EMBL: CP000859.PE444

CP000859.PE444       Location/Qualifiers
FT   CDS_pept        511883..512101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_A0034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66254"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTJ0"
FT                   /protein_id="ABW66254.1"
FT                   /translation="MRITLSIPDEVAHRFQAAIPARQRSGLVTRLLEQELKKRDNSLAA
FT                   ACRAANRDKALEQEIDEWQAFDGGIEE"
     atgagaatta cattatccat accagatgaa gtggcccacc gattccaggc ggcaatacct        60
     gcccgtcagc gatctggcct tgttacacgt ttattggagc aggaattaaa gaaacgtgat       120
     aactcgctgg cagctgcttg ccgggcagcc aatcgtgaca aagccttgga gcaagagata       180
     gacgagtggc aggcatttga tggcggaatc gaggaatga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page