(data stored in ACNUC7421 zone)

EMBL: CP000859.PE445

CP000859.PE445       Location/Qualifiers
FT   CDS_pept        513192..513581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66255"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTJ1"
FT                   /protein_id="ABW66255.1"
FT                   /translation="MGQWKKESLEYTDQFIELLAKEKYDELRTLYNISGDKLEDFKIKF
FT                   GKISDYKYGFTNSSKSGVSGQFTGYFMHYIIQFHSEESYQGTFSISIDNNGNKPIPGEI
FT                   NCFTVRGRDQSREKIFHIYMKENRS"
     atgggacaat ggaaaaaaga gtcacttgaa tatacagacc agttcattga actgcttgca        60
     aaagaaaaat atgatgaatt gagaacacta tataatattt caggtgacaa gttagaagat       120
     ttcaaaatca aatttggaaa gatatcagat tataaatatg gctttacaaa ttcatctaaa       180
     tctggagttt ctggccagtt taccgggtat tttatgcatt atattattca atttcattcc       240
     gaagaatctt atcaaggaac atttagcata agcattgata ataatggtaa taagcccata       300
     ccaggagaga ttaattgttt tacagttcga ggaagggacc aaagcagaga aaaaattttt       360
     catatatata tgaaagaaaa cagaagctaa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page