(data stored in ACNUC7421 zone)

EMBL: CP000859.PE45

CP000859.PE45        Location/Qualifiers
FT   CDS_pept        complement(54839..55024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0045"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: sat:SYN_00926 sec-independent protein
FT                   translocase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65855"
FT                   /db_xref="GOA:A8ZRT8"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRT8"
FT                   /protein_id="ABW65855.1"
FT                   /translation="MFGIGMPELIIILVIVLIIFGAGKLPDIGAGIGKSIKNFKKATAE
FT                   VEENDSDKEKIEDKKS"
     atgtttggca tcggcatgcc ggaactgatt atcattcttg tgatcgtgct gatcatcttc        60
     ggcgcaggca agctgcccga catcggcgcg ggcatcggca agagcattaa aaactttaaa       120
     aaagccacgg ccgaggtcga agagaacgac agcgacaagg aaaagatcga agacaagaag       180
     tcctga                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page