(data stored in ACNUC7421 zone)

EMBL: CP000859.PE450

CP000859.PE450       Location/Qualifiers
FT   CDS_pept        517894..518922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0450"
FT                   /product="Nitrate reductase gamma subunit"
FT                   /note="PFAM: Nitrate reductase gamma subunit; KEGG:
FT                   sfu:Sfum_1146 nitrate reductase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66260"
FT                   /db_xref="GOA:A8ZTJ6"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTJ6"
FT                   /protein_id="ABW66260.1"
FT                   /translation="MNVSYLFAFVAVVVLILLAWAGVGAWGMTGVFGILVPYAAMLLFV
FT                   VGFARKILDWSNSYVPFRIPTTCGQQKSLPWIRQNKIDNPNTTGGVIVRMLLEILLFRS
FT                   LFRNTRAKFKDNNRLSYRWEIVLWVAALAFHYAFAVTLLRHMRFFFEPVPMVIQLLESA
FT                   DAFFRVEFFSPYFVIGLPGVYASGLVLLGALLLLLGRRIFLSQVRYVSLAADFFPLFLI
FT                   IGIAASGILMRYFAKVDISAIKTFAMGLATFKPVPPDGVSALFYVHLFLVSVLAAYFPF
FT                   SKLMHAGGVFLSPTRNMANNNRAVRHVNPWNYSVHTHTYDEYEDEFREKMIEAGLPVEK
FT                   EQ"
     atgaatgtaa gttacctgtt tgcatttgtg gcggttgtcg tgctgatcct gcttgcatgg        60
     gccggtgtgg gcgcatgggg aatgaccggc gtgttcggca ttctcgtccc ttatgcggcc       120
     atgctcctgt ttgtcgtggg atttgccaga aagattctgg actggagcaa ctcctatgtg       180
     cctttccgca ttcccaccac ctgcggccag cagaagtctc tgccctggat ccggcagaac       240
     aaaatcgaca acccgaacac caccggcggg gtgattgttc gcatgctgct ggaaatttta       300
     ctgttccggt ccctttttcg gaacaccagg gccaagttca aagacaataa ccggctctcc       360
     taccggtggg aaatcgttct gtgggtggcg gccctggcct ttcactatgc gtttgccgta       420
     accctgctgc gccacatgcg cttcttcttc gagcccgtgc ccatggtgat tcaactgctg       480
     gaaagcgcgg acgccttttt ccgggtggag tttttctccc cctactttgt catcggcctt       540
     cccggcgtct atgcctcggg cctggtgctg ctgggcgccc ttcttttact gctgggccgc       600
     cggatttttc tttcccaggt gcgttatgtc tccctggccg cggacttttt cccgctgttc       660
     ctgatcatcg gtattgccgc ttccggcatc ctgatgcgct actttgccaa ggtggatatc       720
     tccgccatca aaacctttgc catgggactg gcaacgttta aaccggtacc gccggacggg       780
     gtgagcgcgc tgttttatgt ccacctgttt ctggtcagcg tgctggcggc ctatttcccc       840
     ttcagcaagc tgatgcacgc cggcggggtc tttctgtccc ccacgcggaa catggccaat       900
     aacaaccgtg cggttcggca tgtaaaccca tggaactatt ccgttcatac ccatacctat       960
     gacgaatacg aagatgagtt cagagaaaag atgatagaag ctggattacc agtggaaaag      1020
     gagcaatag                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page