(data stored in ACNUC7421 zone)

EMBL: CP000859.PE453

CP000859.PE453       Location/Qualifiers
FT   CDS_pept        520951..521784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0453"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: dvl:Dvul_1778 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66263"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTJ9"
FT                   /protein_id="ABW66263.1"
FT                   /translation="MESNRRAFLKIAGITAAGITVAPVLTRFTASAEDTAQKGGAPSGK
FT                   TMSGTEALTARHWGMVIDTRQFTSAADLDPLIEACHKVHNVPTFETDLETPFFSADKNR
FT                   HEIKWLWEDEFKHVFPDAENKYLAQRLAELPFLALCNHCENPPCVRACPTKATFQREDG
FT                   IVMMDFHRCIGCRFCMAACPYGSRSFNFRDPREGLKETNIAFPTRMKGVVEKCNFCAER
FT                   LAKGQLPACVEASNGAILFGDLDDPASEVRRALEENFTIRRKPSLGTEPSVYYIV"
     atggaaagca acagaagagc atttctgaaa atagccggta tcacggcggc ggggatcacc        60
     gtggctccgg tcctgacccg gttcaccgcg tcggccgagg acacggccca gaaaggcggg       120
     gcgccctccg gaaagaccat gagcggcacc gaggccctga ccgccaggca ctggggcatg       180
     gtcattgata cgcgccagtt tacctccgcg gccgacctgg accccctcat tgaggcctgc       240
     cacaaggtcc acaatgtgcc gacctttgaa accgacctgg agaccccgtt tttttcagcg       300
     gacaagaacc ggcacgagat caagtggctc tgggaagacg agttcaagca cgtgtttccg       360
     gacgcggaaa acaagtacct ggcccagcgc ctggcggagc tgccttttct ggccctgtgc       420
     aatcactgcg aaaatccgcc ctgtgttcgg gcatgcccca ccaaggccac ttttcaacgg       480
     gaagacggca tcgtgatgat ggattttcat cggtgtatcg gctgccggtt ctgcatggcc       540
     gcctgcccct acggttcccg gagcttcaac ttccgggatc cccgggaggg gctgaaggaa       600
     accaacatcg cttttcccac gcgcatgaag ggtgttgtgg aaaaatgcaa tttctgcgcc       660
     gagcggctgg caaagggtca gctgcccgcc tgcgtggagg cctccaacgg cgccatcctg       720
     ttcggtgacc tggacgatcc cgcctccgag gtgcgacggg cactggaaga aaacttcacc       780
     atccggcgca agccgtccct ggggacagag ccttccgttt actacatcgt ttaa             834
//

If you have problems or comments...

PBIL Back to PBIL home page