(data stored in ACNUC7421 zone)

EMBL: CP000859.PE456

CP000859.PE456       Location/Qualifiers
FT   CDS_pept        complement(523994..525079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0456"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: chy:CHY_0095 iron-sulfur cluster-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66266"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTK2"
FT                   /protein_id="ABW66266.1"
FT                   /translation="MSDQTYRTAASAVIAAGAIPFPVNDTLLEILKNIMTPEQAGFVQL
FT                   LDRPLNREEIKKKSGMADADLDQMLNSLMKSGVISGTASRGSGLMVYRAMPPIPGIFET
FT                   TMMRGETGEKQKTLARLFENLFEELAGMVQANYDAIVPAFKAMPPMTRIVPVEKHIDRA
FT                   FDTVMPCEDVKKLVDRFDTIGVATCYCRHQKDLLDRPCKVTDERKNCLFFGKTAEFFIT
FT                   YGFAEPITQDQAKQILEKAEADGLVHKAFHEKYDTGRNEMAICNCCKCCCETFQSYYRG
FT                   SSPTITYAAYVARVDADTCTGCEACADICPMEAIEMKDDIAHVSDSRCIGCGVCAYHCP
FT                   ADALALERTGQREVFVPPPKH"
     atgagcgacc agacctaccg aaccgcggca tcagccgtta tcgcggccgg agccattccc        60
     tttccggtca acgacaccct gcttgaaatt ctgaaaaaca tcatgacccc ggaacaggcc       120
     gggtttgttc aactgctcga ccggccgtta aaccgggaag agatcaagaa aaaatcgggc       180
     atggcggacg cggacctgga ccagatgctc aacagcctga tgaaaagcgg tgtgatttca       240
     gggacggcca gccggggctc gggcctgatg gtctaccggg ccatgccgcc cattcccggt       300
     atctttgaaa ccaccatgat gcggggggag accggggaaa agcagaaaac cctggcccgg       360
     ctctttgaaa acctgtttga agagcttgcc ggcatggtcc aggccaacta cgatgcgatt       420
     gtgccggcgt ttaaagccat gccgcccatg acccgcattg tcccggtgga aaagcacatt       480
     gacagggctt ttgacacggt gatgccctgc gaggacgtca aaaaactggt ggaccgcttt       540
     gataccattg gtgtggccac ctgctactgc cgccaccaga aggaccttct cgaccggccg       600
     tgcaaggtga ccgacgaaag gaaaaactgc cttttcttcg gcaagaccgc cgagtttttc       660
     atcacctacg gatttgccga gcccatcact caggaccagg ccaaacagat cctggaaaag       720
     gccgaggcag acggcctggt acacaaggcg tttcatgaaa agtacgacac cggcagaaac       780
     gaaatggcca tctgcaactg ctgcaagtgc tgctgtgaga ccttccagtc ctactaccgg       840
     ggcagttcgc ccaccatcac ctacgccgcc tatgtcgcac gggtggatgc cgatacctgc       900
     accgggtgcg aggcctgcgc cgacatctgt cccatggagg ccattgaaat gaaagacgac       960
     atcgcccatg tctcggactc ccgttgcatc gggtgcggcg tgtgcgccta tcactgcccg      1020
     gctgacgccc tggccctgga gcggaccggt caacgggagg tgtttgtgcc accgcccaaa      1080
     cactag                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page