(data stored in ACNUC7421 zone)

EMBL: CP000859.PE459

CP000859.PE459       Location/Qualifiers
FT   CDS_pept        complement(526887..527270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0459"
FT                   /product="hmc operon protein 6"
FT                   /note="KEGG: dde:Dde_0648 hmc operon protein 6"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66269"
FT                   /db_xref="GOA:A8ZTK5"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTK5"
FT                   /protein_id="ABW66269.1"
FT                   /translation="MKANTKGVNPKAIQDIIEKDKAKIAFSLKACAHCSMCAESCFLFQ
FT                   ARNQDPKYMPSYKFLSTLGVIYKKKGKVDRQTLEEMRETVWKRCVLCTRCYCPMGIDIP
FT                   YMIRLTRRICRSQGVYHTYDTEA"
     atgaaagcaa acacaaaagg cgtaaatccg aaagccattc aggatattat tgaaaaggat        60
     aaagccaaga ttgccttttc ccttaaggcc tgcgcccact gcagtatgtg cgcggagagc       120
     tgctttctgt ttcaggccag gaaccaggac cccaaataca tgccgtccta caagtttttg       180
     tccaccctgg gcgtgattta caagaaaaag ggaaaggtgg accggcagac cctggaggag       240
     atgcgggaga ccgtgtggaa acggtgtgtg ctgtgcaccc gctgttactg ccccatgggc       300
     atcgacatcc cctacatgat ccggctgacc cgccgcatct gccgcagcca gggagtgtat       360
     cacacatatg acacggaagc gtaa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page