(data stored in ACNUC7421 zone)

EMBL: CP000859.PE46

CP000859.PE46        Location/Qualifiers
FT   CDS_pept        55182..56252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_3079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65856"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRT9"
FT                   /protein_id="ABW65856.1"
FT                   /translation="MKASFYPDRRAALIGSLPMTDHAAATQLVFEHAPDIPLWVQLPAY
FT                   PAEGMLAQFLPGFPGVSEQNGKLFINTQDPAFHDDVLGFYEAYLAAEQDPSVLDGSVFA
FT                   LDTTVAAGFFEFLNQAGPVADRLFAVKGQITGPFTFATGVTDDQGRALFYDDQLRDVAV
FT                   KLIAAKARWQARRLAALGRPVIIFFDEPALTAFGSSAYISISRADVTACFEEVFAAVHA
FT                   EGALAGVHVCANAEWDLILDSSADIVSFDSYSFFDKFVLYADHIRRFIDREGLLAWGIV
FT                   PTGDKEAIGKETVASLVALWHEQVARVEKLGIDRTTIERLSLITPSCGTGSLDMDSALR
FT                   VLELNAGVSKALRAGQ"
     atgaaagcat cgttttatcc ggaccggcgg gccgccctga tcggcagcct gcccatgacc        60
     gaccatgcag cagccacgca actggtgttc gaacacgcgc ccgatattcc gctgtgggtg       120
     cagttgccgg cctacccggc cgagggcatg ctggcccagt ttctgcccgg gtttcccggt       180
     gtgagcgaac agaacggcaa gctgtttatc aacacccagg accctgcctt tcatgacgac       240
     gtgctgggct tttatgaggc ttacctggca gcggagcagg acccgtccgt gcttgatggt       300
     tccgttttcg ccttagacac cacggtggcc gccgggtttt tcgagttttt aaaccaggcc       360
     gggcctgttg ccgaccggct gtttgccgtc aagggccaga tcaccggacc ctttaccttt       420
     gccacgggcg tgacagacga ccagggccgt gccctgtttt acgacgacca gcttcgggac       480
     gtggcggtca agctgatcgc ggccaaggcc cggtggcagg cccgccgcct ggccgccctg       540
     ggccggccgg tgatcatttt ttttgacgag ccggccctga ccgcattcgg ctcttcggcg       600
     tatatcagta tctcccgggc cgatgtaacg gcctgctttg aggaggtgtt tgccgcggtg       660
     catgccgaag gtgccttggc cggggtccat gtgtgcgcca atgccgagtg ggacctgatt       720
     ttggattctt cggccgatat cgtcagcttt gacagttatt ccttttttga caagtttgtg       780
     ctctacgcgg accacatccg gcggtttatc gaccgggaag gacttctggc ctggggcatt       840
     gtgcccaccg gcgacaaaga ggcgattggc aaagagaccg tggcgtccct ggtcgcactc       900
     tggcatgaac aggtcgcccg ggttgaaaag ctgggcatcg acaggacaac cattgagcgg       960
     ctctcgctga tcacgccgag ctgcggcacc gggtctcttg acatggactc ggccctgcgt      1020
     gtgctggaat tgaatgccgg ggtgtcgaaa gcgctgcggg ccgggcaatg a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page