(data stored in ACNUC7421 zone)

EMBL: CP000859.PE461

CP000859.PE461       Location/Qualifiers
FT   CDS_pept        complement(528005..528685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0461"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: chy:CHY_1232 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66271"
FT                   /db_xref="InterPro:IPR022026"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTK7"
FT                   /protein_id="ABW66271.1"
FT                   /translation="MVKAKRKPLEEIADCVKGYTKILNIGCGGCVSVCMAGGQREVNTT
FT                   NAELTLLFQEKEITSRIDGYTVERQCNAALLEELDDLVVRYDCLVSMACGAGVQMLAER
FT                   YPSKPVFPAQNTIAIGVDREMGIYEERCRACGFCVLAYTGGICPVTRCSKGLFNGPCGG
FT                   TNNGKCEISNDVSCAWNDIYNRLKQQNRLNDILRIQAAMEWQNTTPRTFVQTGYEHRYA
FT                   KEEA"
     ttggtcaaag caaaacgtaa accactggaa gaaatagccg attgtgtcaa ggggtacacc        60
     aagatcctga acatagggtg cggcggctgc gtatcggtat gcatggccgg cggccagcgc       120
     gaggtcaaca ccaccaatgc tgagctgacc cttcttttcc aggaaaaaga aatcacctcc       180
     cgtatcgacg ggtataccgt tgagcggcag tgcaacgcgg ccctcctgga agagctggac       240
     gacctggtgg tccggtatga ctgtctggtc tccatggcct gcggcgccgg tgtccagatg       300
     ctggcagagc gctacccttc caaaccggtt tttccggccc agaacaccat tgccatcggt       360
     gtggaccggg agatgggcat ctacgaagaa aggtgccggg cctgcggttt ctgcgtgctg       420
     gcctacaccg gcggcatctg cccggtaacc cgctgttcaa aaggcctgtt caacggcccc       480
     tgcggcggta ccaacaacgg caagtgcgag atcagcaacg acgtctcctg cgcctggaac       540
     gacatctata accggctcaa acagcagaac cggttaaacg acatcctccg gattcaggcg       600
     gccatggagt ggcagaacac aacccctcgc acctttgtgc agaccgggta tgaacacaga       660
     tatgccaagg aagaagcgta a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page