(data stored in ACNUC7421 zone)

EMBL: CP000859.PE467

CP000859.PE467       Location/Qualifiers
FT   CDS_pept        complement(532231..533535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0467"
FT                   /product="FolC bifunctional protein"
FT                   /note="TIGRFAM: FolC bifunctional protein; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein; KEGG: sfu:Sfum_1671 FolC
FT                   bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66277"
FT                   /db_xref="GOA:A8ZTL3"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTL3"
FT                   /protein_id="ABW66277.1"
FT                   /translation="MARQSEYQRLIHEMYNLRRFGIKLELTTMQRMLDALGRPHTRYET
FT                   IHIAGTNGKGSIATTLATILHAAGYRTGLYTSPHLVTFNERIQINNRPVSNAAVVRACK
FT                   AVRGLSGDGREPTFFEYTTAMAFYLFAELGVDIAVIETGMGGRFDATNIITPCLSVISN
FT                   ISVEHRMYLGNTLGEIAGEKAGIIKPGVPVVTGARQKPVLDVIKKVAKKQAAPLYRLGG
FT                   EFRVRRHGDGTFSYHGISHRWDRLRTVLAGGFQMDNAALALAGCELLMASGKPLSEATV
FT                   RKGLASTRWPARLEIVSDSPTILIDGAHNLQAAKNLAAFLSEQMAGRKITLVAGILDDK
FT                   PYRAMLRALVPLCDRVILTRAQIGRAIAPEILEREARNLGATRTHVVDRVDKALAFALA
FT                   HTPKKSGAVCVAGSLYVAGEARHAIKKQGEMQPAI"
     atggcacgac agagcgagta ccagcgactg atccatgaga tgtacaacct gagacggttc        60
     gggatcaagc ttgagctgac caccatgcag cgcatgctcg acgccctggg ccggccccac       120
     acccggtatg aaacgattca catcgccggc accaacggca agggatccat tgcaaccacg       180
     cttgccacga tcctgcacgc ggccggttac aggacgggac tctacacctc cccccacctg       240
     gtcacgttca acgagcggat tcagatcaac aaccggccgg tgagcaacgc cgcggtggtc       300
     cgcgcctgca aggcggtccg ggggctttcc ggcgacggcc gggaacccac cttcttcgaa       360
     tacaccacgg ccatggcctt ttacctgttt gccgaactgg gggtcgatat cgcggtgatt       420
     gaaaccggca tggggggccg gtttgacgcc accaacatta ttactccctg cctgtcggtg       480
     atctccaata tctcggtgga gcaccgcatg tacctgggca acacccttgg agagatcgcc       540
     ggggaaaagg ccggcatcat caaacccggc gtgccggtgg tcaccggggc ccggcaaaag       600
     ccggtcctgg acgtgatcaa aaaagttgca aaaaaacagg cggccccgct gtaccggctc       660
     ggcggagagt tccgggtccg gcgccatggt gacggcacct tttcgtacca cggaatctcc       720
     caccggtggg accggctgcg caccgttctg gccggcggtt ttcagatgga taacgcggcc       780
     ctggccctgg cgggctgcga actgctgatg gcatcgggca aacccctttc cgaggccact       840
     gttcgcaaag gactggcatc cacccggtgg ccggcccgcc tggaaatagt ctctgattca       900
     ccgaccatcc tgatcgacgg ggcccacaac cttcaggccg cgaaaaacct ggcggccttt       960
     ctgtccgagc agatggcggg ccggaaaatc acccttgtgg cgggcattct ggacgacaag      1020
     ccctatcggg ccatgctccg ggcactggta cccctgtgcg accgggtgat cctgacccgg      1080
     gcgcagatcg gccgggccat tgccccggaa attcttgaac gggaggcccg taatctgggc      1140
     gcaacccgca cccatgtcgt cgaccgggtg gacaaggccc tggcctttgc cctggcccac      1200
     acgccaaaaa aatccggcgc cgtctgcgtg gccggttccc tttacgtggc cggcgaggcc      1260
     cggcacgcca taaagaaaca gggcgagatg cagccggcga tttga                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page