(data stored in ACNUC7421 zone)

EMBL: CP000859.PE468

CP000859.PE468       Location/Qualifiers
FT   CDS_pept        complement(533608..533814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0468"
FT                   /product="ribosomal protein S21"
FT                   /note="TIGRFAM: ribosomal protein S21; KEGG: pca:Pcar_2255
FT                   30S ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66278"
FT                   /db_xref="GOA:A8ZTL4"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTL4"
FT                   /protein_id="ABW66278.1"
FT                   /translation="MKEIEVRVIDNDLEKAMRILKKKIQNDGLFKRLRLRKTYEKPSEF
FT                   KRRKEREAQRRLRIAEIKRRRFR"
     ttgaaggaaa tcgaggttcg cgtcattgat aatgaccttg aaaaggccat gcggattctg        60
     aagaaaaaaa ttcagaacga cgggcttttc aaacggctcc ggctcagaaa aacctatgaa       120
     aaacccagcg agttcaaacg caggaaagag cgggaagccc agagacggtt gcgaatagcc       180
     gaaatcaagc ggcgccggtt cagataa                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page