(data stored in ACNUC7421 zone)

EMBL: CP000859.PE469

CP000859.PE469       Location/Qualifiers
FT   CDS_pept        complement(534043..534717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0469"
FT                   /product="adenylate kinase"
FT                   /note="PFAM: adenylate kinase; KEGG: dde:Dde_2028 adenylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66279"
FT                   /db_xref="GOA:A8ZTL5"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZTL5"
FT                   /protein_id="ABW66279.1"
FT                   /translation="MNILFFGPNGSGKGTQGAILKEKYSLPHIESGAIFRENISKGTEL
FT                   GAKAKEYIDRGDLVPDDITIPMILDRLQQDDCKKGWLLDGFPRNKVQAETLDATLKKAN
FT                   MALDIVVEIELDREIAKNRIMGRRLCVNDNNHPNNIFIDAIKPDGDKCRVCGGELKTRS
FT                   DDQDEAAIDKRHNIYYDTETGTLAAAYYFRDLAAKGGSLKYITLDGAPGVKEVAAELVS
FT                   KL"
     atgaacattc tgtttttcgg ccccaatggc agcggcaagg gcacacaggg cgccattctg        60
     aaggaaaagt acagcctgcc ccatatcgag tcaggcgcca tcttccggga aaacatctcc       120
     aagggaaccg agctgggcgc aaaggcaaaa gaatatattg accgcggcga cctggtcccc       180
     gacgacatca ccattcccat gattctggat cggctgcagc aggatgactg caaaaaggga       240
     tggcttctgg acgggtttcc cagaaacaag gtccaggccg aaaccctgga cgcgaccctg       300
     aaaaaagcca acatggcgct ggacatcgtg gtggaaatcg agctggaccg cgagatcgcc       360
     aagaaccgga tcatgggcag gcggctctgc gtcaacgaca acaaccatcc caacaatatt       420
     tttatcgacg ccatcaaacc cgacggcgac aagtgccggg tctgcggcgg ggaactgaaa       480
     acccgcagcg atgaccagga cgaggcggct attgacaagc gccacaacat ctactacgac       540
     accgaaaccg gtaccctggc tgctgcctac tacttccgtg acctggcggc aaagggcggc       600
     tccctcaagt acatcaccct cgacggcgcc cccggcgtca aagaggttgc cgcggagctg       660
     gtttccaagc tgtag                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page