(data stored in ACNUC7421 zone)

EMBL: CP000859.PE476

CP000859.PE476       Location/Qualifiers
FT   CDS_pept        540612..541349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0476"
FT                   /product="uridylate kinase"
FT                   /note="TIGRFAM: uridylate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: ade:Adeh_0280
FT                   uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66286"
FT                   /db_xref="GOA:A8ZTM2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTM2"
FT                   /protein_id="ABW66286.1"
FT                   /translation="MTPRYKRVLLKLSGEALMGDQTMGISPDVLQYVAEEIESICRMGV
FT                   QLAVVVGGGNIFRGVAASSYGMDRTSADHMGMLATVINSIALQDAIEKRGIATRVQSAI
FT                   EVHAVAEPYILRKALRHLEKGRVVIFAAGTGNPYFTTDTAAVLRAEEIHAELLLKATKV
FT                   NGLYDSDPVKNSGARFIKQITYMDVIKRQLAVMDATAITLAMDNHLPLVVFSMRDKGNA
FT                   RRIICGEDLGTYIGDEASADQSI"
     gtgacacctc ggtataaacg cgtactgctg aaactcagcg gcgaggccct gatgggagac        60
     cagaccatgg gcatcagccc cgacgtgctt cagtacgtgg ccgaggagat cgagtccatc       120
     tgccgaatgg gggtccagct ggccgttgtg gtggggggcg gcaacatctt tcggggtgtg       180
     gccgccagct cctacggcat ggaccgtacc tccgccgatc atatgggcat gctggccacg       240
     gtgatcaaca gcatcgccct gcaggacgcc attgaaaaac ggggcatcgc cacccgggtg       300
     cagtccgcca tcgaggtgca tgccgtggct gaaccgtata tcctgcgcaa ggccctgcgt       360
     cacctggaaa agggccgggt ggtgattttt gccgccggca ccggcaatcc ctatttcacc       420
     accgacaccg ccgccgtgct gcgggccgag gagattcacg cggaactgct gctcaaggcc       480
     accaaggtca acgggctgta tgattcggat ccggtgaaaa acagcggcgc ccggtttatc       540
     aaacagatta cctacatgga tgtgatcaag cggcagctgg cggtgatgga tgccacggcc       600
     atcaccctgg ccatggacaa ccatctgccc ctggtggtgt tttccatgcg ggataaggga       660
     aatgcccggc gtatcatctg cggcgaagac ctgggcacct acatcggcga cgaagcttca       720
     gcggaccaat caatctga                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page