(data stored in ACNUC7421 zone)

EMBL: CP000859.PE482

CP000859.PE482       Location/Qualifiers
FT   CDS_pept        545871..548867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0482"
FT                   /product="Phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /note="PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein; KEGG: sfu:Sfum_0432
FT                   phosphoribosylformylglycinamidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66292"
FT                   /db_xref="GOA:A8ZTM8"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTM8"
FT                   /protein_id="ABW66292.1"
FT                   /translation="MAHRLEIALKPGLTDAQGQKVKKRAADYLSISLSDVRVVHVITLD
FT                   AALSEPQQWAVQEIFTNPVTQVSSFGPLAVAFDWIIWVGLRPGVKDNAGDTAKEAISDS
FT                   LGRTFTDDEGVYTSRRYCLTGDGLSREQVETIARELLANDTIEQWRLFSKEEWDDTSGI
FT                   GLIIPRVRLAHSPTVTLIPVESDAALMKVSDERNLALNPNDVPVIREYFVRKEVRERRR
FT                   AVGLSDPTDIEVEYISQARSDHCNHNTFGGRFYYKDLITGETLKIDSLFATCIRQPTLD
FT                   LQKEKPWVVSVLWDNAGMARFDEDHCYVITGETHNSPSNMEAYGGAMTGIVGVYRDPMG
FT                   TGKGARLVMGGYGFCTGRRDYDGDLKPRLSPRRLLDGVIEGVKDGGNKSGIPTTFGQLY
FT                   FDDGYMGKCLVFVTAIGILPAYINGEPSDKKTTRPDDLIVMCGGRVGKDGIHGVTASSE
FT                   VYSEHTPAGHVQIGDPYTQKKMHDFLLCARDAGLIQFITDNGGGGLSSSVGESALYSGG
FT                   CEVWLEKVPLKYAGLDQWEIWVSESQERMTVAVAPENIDRFLALSADHAVESTVIGKYT
FT                   DSGMLHILYDGATCAYIDLDFMASDFPQWEFEAHWTPPEARGLCEPVLGGSPDFNTLLS
FT                   DMLARPNICSREWVARQYDHEVQGGSAVKPLVGADRDIASDAAVTRPVLASEKGIAFAQ
FT                   ALLPAYSKIDAYHMTTAVIDEAVRRLVAVGADPAGIGGVDNFCWPNIAYNPASNPDGRF
FT                   KAAQLVRSCLALRDACNAFGIPLLSGKDSMYVDGHLAGRYGETRKVSALPTMQFSATAV
FT                   VDDVTACTTLEAKAEGDLVYVAGITRNELGASEYYELLGFTGLTIPRVRFDESSAVCRA
FT                   VATAIGRGLCASVHGVYRGGLGVHLAFVAMGGNLGMTVDLSKIVQEPGLSDHALLFSES
FT                   PARFVITVAPENRAAFEALWQDAPCACIGTVTGKNGRLTLSGQNGKPLVDREGATLKQT
FT                   WKQPFGNLI"
     atggcccacc ggcttgaaat tgccttaaag cccggtttaa ccgatgccca gggacagaaa        60
     gtcaaaaaaa gggccgcgga ctacctgtcc atctctctgt ccgacgtgcg ggtggtccat       120
     gtgatcaccc ttgacgcggc gctgtccgag ccccagcagt gggccgtgca ggagatattc       180
     accaacccgg tgacccaggt ctcttccttt ggtcccctgg ccgtggcctt tgactggatc       240
     atttgggtgg ggctgcggcc cggcgtcaag gacaatgccg gcgacaccgc aaaagaggcc       300
     atctccgaca gcctgggccg cacgtttacc gatgacgagg gggtctacac ttccaggcgg       360
     tactgcctga caggcgacgg tctttcccgg gagcaggtgg agaccattgc aagagagctg       420
     ctggccaacg acaccattga gcagtggcgc ctgttttcaa aagaggagtg ggacgatacc       480
     tccggcatcg gcctgatcat tcccagagtg cggctggccc acagcccgac agtgaccctg       540
     atcccggtgg aaagcgacgc cgccctgatg aaggtgagcg acgagcgcaa cctggccttg       600
     aaccccaacg acgtgcccgt gatccgtgaa tattttgtgc gaaaagaggt ccgggagcgg       660
     cgccgggccg tgggcctctc cgaccccacc gacatcgagg tggagtatat ctcccaggcc       720
     cgcagcgacc actgcaacca caacaccttt ggcggccggt tctattataa agacctgatc       780
     accggggaaa ccctgaagat tgacagcctg tttgccacct gtatccggca gcccaccctg       840
     gacctgcaaa aagaaaaacc gtgggtcgtg tccgtgctgt gggacaatgc cggcatggcc       900
     cggttcgacg aggaccactg ctacgtgatc accggcgaga cccacaactc cccctccaac       960
     atggaggcct acggcggcgc catgaccggt attgtgggcg tctaccggga ccccatgggc      1020
     acgggcaaag gcgcccggct ggtcatgggg ggctacgggt tctgcacggg aaggcgcgac      1080
     tatgacgggg accttaagcc caggctgtct ccccgccgcc tgctggacgg ggtgatcgag      1140
     ggggtcaagg acggcggtaa caagagcggc attcccacca cctttggcca gctctatttt      1200
     gacgacggtt acatgggcaa gtgcctggtc tttgtcacgg ccatcggtat tctgcccgcc      1260
     tatattaatg gtgagccctc ggacaaaaag accacgcggc ccgacgacct gatcgtgatg      1320
     tgcgggggcc gggtgggcaa ggacggcatt cacggcgtga ccgcgtcttc cgaggtttac      1380
     tccgagcaca cgccggcggg ccatgtgcag atcggcgacc cctacaccca gaagaagatg      1440
     cacgattttc tgctgtgcgc cagggacgcg gggctgatcc agtttatcac cgacaacggc      1500
     ggcggcgggc tctcctcgtc tgtgggcgag tcggccctct attcaggcgg gtgcgaggtg      1560
     tggctggaaa aggtgccgtt gaaatacgcg ggcctggacc agtgggagat ctgggtctcc      1620
     gagtcccagg agcgcatgac cgtggccgtg gccccggaaa acatcgaccg ttttttagcc      1680
     ctgtccgccg accatgccgt ggagtccacg gtaatcggca aatacaccga ttcgggcatg      1740
     ctccatattc tttacgatgg cgccacctgc gcctatatcg acctggattt catggcctcc      1800
     gatttccccc agtgggagtt tgaggcccac tggaccccgc cggaagcccg gggcctgtgt      1860
     gagccggtgc tgggcggcag cccggatttt aacaccctgc tgtccgacat gctggcccgg      1920
     cccaatatct gctccaggga gtgggtggcc cggcagtacg atcacgaggt tcagggcggc      1980
     agtgcggtca agcccctggt gggcgcggac cgggacattg cctcggacgc ggccgtgacc      2040
     cggccggtgc ttgcttctga aaaaggcatt gcctttgccc aggccctgct gccggcctat      2100
     tcgaagatcg acgcctacca catgaccacc gcggtcattg acgaggcggt acggcggctg      2160
     gtggctgtgg gcgctgaccc ggccggcatc ggcggggtgg acaacttctg ctggcccaac      2220
     atcgcctaca atccggcatc caacccggac ggccggttca aggcggccca gctggtgcgc      2280
     tcctgcctgg ccctgcgcga cgcgtgcaac gcctttggta tcccccttct ttccggtaag      2340
     gacagcatgt acgtggacgg ccacctggcc ggccggtacg gcgagacccg caaggtttcg      2400
     gccctgccca ccatgcagtt ttccgccacg gcagtggttg acgacgtcac ggcctgcacc      2460
     actctggagg ccaaggccga aggggatctg gtctatgtgg cgggcatcac ccggaacgaa      2520
     ctgggggcat ccgagtatta tgagcttctg ggatttaccg gacttaccat cccccgggtt      2580
     cggtttgacg aaagcagtgc cgtgtgccgg gccgtggcaa ccgccattgg ccggggtctg      2640
     tgcgcctcgg tacacggcgt ctaccgcggc gggctggggg tccacctggc ctttgtggcc      2700
     atgggcggca acctgggcat gaccgttgac ctgtcaaaga tcgttcagga gccgggtctt      2760
     tccgatcatg ccctgctttt ttcagaaagc ccggcccggt ttgttatcac cgtggccccg      2820
     gaaaaccggg ccgcctttga agctttatgg caggacgcgc cctgcgcctg tatcggcacg      2880
     gtgaccggta aaaacgggcg cctgaccctg tccgggcaaa acggcaaacc gctggtggac      2940
     cgggaggggg ctacgctcaa acaaacctgg aaacaaccat tcgggaacct gatatga         2997
//

If you have problems or comments...

PBIL Back to PBIL home page