(data stored in ACNUC7421 zone)

EMBL: CP000859.PE485

CP000859.PE485       Location/Qualifiers
FT   CDS_pept        complement(551100..551726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slo:Shew_3606 signal recognition
FT                   particle-docking protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66295"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTN1"
FT                   /protein_id="ABW66295.1"
FT                   /translation="MKYRIWTTMFFIAVWCLAPGTASADIYKYVDESGRVHYTNNPDSI
FT                   PKAAHETVVVDQEVESRSPDPAQPQEMAPEEGAPQETDTPLTRISQQRNHLHTERKNAL
FT                   VKRQQALNEERQALQAENTRLETLRRTANTRAEIERYNAEVEQYNQRTAAYQAQKNAYQ
FT                   QEKELFQKEVEAYQAELKKTLEATLEKMEKSPSQPAASPPPEETP"
     atgaaatacc ggatatggac cacaatgttt tttattgccg tctggtgtct ggcacccggc        60
     actgcgtcag ccgatatcta taagtatgtg gatgaaagcg gccgggttca ctacaccaac       120
     aaccccgact ccattccaaa ggccgcccat gagacggttg ttgtcgacca ggaggtggaa       180
     agccgatctc cggacccggc gcaaccgcag gagatggcac cagaagaggg cgcgccgcaa       240
     gagaccgata cccccctgac ccggataagt cagcagcgaa accacctgca caccgaacga       300
     aaaaatgccc tggtaaaacg gcaacaggcc ctgaatgagg aacgccaggc cctccaggcg       360
     gaaaacaccc ggctggaaac acttcgccgc actgccaata caagggcgga gattgaacga       420
     tacaatgcgg aagtagagca gtacaatcaa cggaccgctg cctaccaggc gcagaaaaac       480
     gcttatcagc aagaaaaaga gctgtttcaa aaagaggttg aggcctacca ggccgaattg       540
     aaaaaaacac tggaagccac actggaaaag atggaaaaaa gcccttctca accggcagcc       600
     tcgccacccc ctgaagaaac cccctga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page