(data stored in ACNUC7421 zone)

EMBL: CP000859.PE486

CP000859.PE486       Location/Qualifiers
FT   CDS_pept        552061..552564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0486"
FT                   /product="pilin assembly protein"
FT                   /note="KEGG: sat:SYN_01761 pilin assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66296"
FT                   /db_xref="GOA:A8ZTN2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTN2"
FT                   /protein_id="ABW66296.1"
FT                   /translation="MNREMKKGFTLMELMVVVAITAVIMAIAIPNVVSWRNNQQLSRAA
FT                   RQVFVDIQATRMSAVKYNQFAFIQFDTGNGTYVAWRDSPDGAASGVLDPGDDNVILRGN
FT                   MPPGVEMSAAAFSAPNGDTAGFSPMGLCRWPSGAFRSGSVTVTNGVRDSRIILNESGRI
FT                   RTES"
     atgaacaggg aaatgaaaaa agggtttaca ctgatggagc tgatggtggt ggttgccatt        60
     accgccgtga tcatggccat tgccataccc aacgtggtgt cctggcggaa caaccagcag       120
     ctttccaggg cggcccggca ggtctttgtg gatattcagg ccacaagaat gtcggccgtc       180
     aaatacaatc agtttgcctt tattcagttt gataccggca acggaacata cgtggcctgg       240
     cgggattcgc cggacggtgc ggccagcggt gtgctggacc ccggggatga caacgttatt       300
     ctgcggggca atatgccgcc gggggtagag atgtcggcgg cggctttttc cgctccaaac       360
     ggcgatacgg ccggcttttc acccatgggt ctctgccggt ggccaagtgg tgccttcagg       420
     agcgggagtg tgaccgtgac caacggggtc cgggacagca ggattatcct taacgagtcc       480
     ggcaggataa gaacagaatc gtga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page