(data stored in ACNUC7421 zone)

EMBL: CP000859.PE489

CP000859.PE489       Location/Qualifiers
FT   CDS_pept        553859..554380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0489"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: noc:Noc_2273 type IV pilus assembly protein
FT                   PilX"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66299"
FT                   /db_xref="GOA:A8ZTN5"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTN5"
FT                   /protein_id="ABW66299.1"
FT                   /translation="MIIRKEAVVKTAFDNLKNQNGSVLALVLMVMVTILIIGITAIHDT
FT                   AIEGKISRNSTIRSISFYRAEAAAREAIQLLENSNTPLTDLIPGSGSAFAWIQDVGFDV
FT                   QADAGASAINSGLVSNAQYLVVYDGFAEEGEMGMEEDTHLYEYIIYGRGFYDVRDQSDC
FT                   TLQMAYRRRF"
     atgatcatca gaaaggaggc tgtggtgaaa accgcatttg ataatctgaa aaaccagaac        60
     gggtccgtgc tggcgctggt gctgatggtg atggtgacca ttctgatcat cggcattacc       120
     gcaatacacg acacggcgat cgaggggaag atatcccgca acagcaccat tcggagcatc       180
     agtttctacc gggccgaagc cgcggcccgg gaggccattc agctgctgga aaattcgaac       240
     acccctctga cggacctgat acccggcagc ggcagcgcct ttgcctggat tcaggacgtg       300
     ggatttgacg tacaggccga tgccggggcc tcggcgatca acagcggtct tgtgtccaat       360
     gcgcagtacc tggtggtgta tgacggtttt gccgaagagg gagaaatggg tatggaagag       420
     gatacccatc tgtacgaata tattatttac ggccgggggt tttatgatgt tcgtgaccaa       480
     agcgactgca cccttcagat ggcctatcgc cgccggtttt ag                          522
//

If you have problems or comments...

PBIL Back to PBIL home page