(data stored in ACNUC7421 zone)

EMBL: CP000859.PE490

CP000859.PE490       Location/Qualifiers
FT   CDS_pept        554441..559078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0490"
FT                   /product="Pyrrolo-quinoline quinone"
FT                   /note="SMART: Pyrrolo-quinoline quinone; KEGG: neu:NE1747
FT                   putative type 4 fimbrial biogenesis protein PilY1"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66300"
FT                   /db_xref="GOA:A8ZTN6"
FT                   /db_xref="InterPro:IPR008707"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR021655"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZTN6"
FT                   /protein_id="ABW66300.1"
FT                   /translation="MNRNIIKCDGKTGPGRAVRTVVCLFVLLLVMSFSAVGAWAGDFGR
FT                   NQDAGDTADRARRYSLDFSGSGQNDEWDWDYDWIKFSLDQTAEVTFTLTNDSRYSYLRV
FT                   TNGATDLLGDWVAANTTQVLTLSPGLYYVCVAAYPNGIFTRTRYTLSISAVYGTACYLD
FT                   ADGDGYGDPTDVIYNASCPAGRVANDDDCDDTDPAKWSGALDICDGIDNDCDGDVDEDC
FT                   ATYYRDTDGDGYGDPGHTASAPAAGFVTLSGDCDDTNSAINPGATEVCDGIDNNCDGAV
FT                   DDINLWYYLDEDGDGYGDPAGELKPCSLTGYEGYVDNGLDCDDFDAAIHPGATEICNNL
FT                   DDNCDGAIDEGLPVVTYYYDQDGDGWGIPTNSQSGCTPPSGNYVEADDADGDGTDDFDC
FT                   NDENPRIHPGAFDPCNTTIDENCANGMDDCEESPAGCANLADYPLETRAISANPMVEFL
FT                   FDDSGSMAWEVMHKGTYNGKFYYQYYYRGVRSASVSDVFNTTSSTDRSFYQTQCADENS
FT                   LYYNPEYSYVPWPGHTPADPDRPKKSPDSSDTITMNDNFSSIGISNAHYFVKDGGNVYL
FT                   VDLDSSGVRYYTVSYETGSYYYGRVNSVSLIGSAPTGVNIGSLAEARQNFANWFQFYRT
FT                   RQNTAKASILQVVNSLSGVKIGVHTINGNNSITIPNTGMLSVDDNKATILGYIEDVGAY
FT                   SGTPLRLGLKAVGNFFAGDYSGVDSPYSTVAAGGECQAAFAIVMTDGYYNGSNPGIGNA
FT                   DADDANNDFDGPPFADSYSDTLADVAMYFYKNDLRDDLADAVPTNEYDQATHQHLVTYG
FT                   VCFGLVGTEDPADYPNCPAGGTGACPDPWPSPGTDEGPGRIDNLYHAAINGRGKFISAS
FT                   NPLQLVEAIRAIMDDVVARRGSGASVAVSTQSLKEDTLLFQGSYDSAGWKGDLRAYSIS
FT                   MMTGLINPNHVWSAAAGLDALTDTEAKARNIFTYDGSTGVAFSYDNLSEDQQSSLGETE
FT                   TDQRLVVDFIKGDRSKEQNNENGLFRIRRSRMGDIVHSAPVHVGDTIYVGGNDGMLYAF
FT                   NALTGAERFAYIPEHLYPYSKLYKLADPNYIHKFYVDNTTFVRNDLLVCGLGRGAKGYF
FT                   ALDVSNPSGFTASDVLWEYPAVTYDGTESDPDMGYTFSRPAVVPCGAYGDVLIFGNGYS
FT                   STNQEAVLYVIDIDDTDGSFEESDVKKIYTGVGSTGTGVCNGLSTPTLIDTDQDGDLDI
FT                   VYAGDLQGNLWKFDLSGTKDTWAVACKDSSGNPKPLFQAKDESGNVQPITTKPAVTKHC
FT                   AGLGYMVAFGTGQFMAEGDFADMSTQALYGIWDWENAWAAADDELSADQLDRMHYGYLR
FT                   APSSGVRLFSEIEASGMFASPNPEVSLTLVKQSQVSLSSSERVTSENDVNWFSPDKWVA
FT                   QREAGETPYSGGQHVGWYLEFPSGGGERVISDPQIRSSKTGNLLIFMSLVPSIEVCRAG
FT                   GYSIFNVLDACTGKWEKGVVLDDIYYKPPIIDPPEPPPPLDDDDDNDDGYIGDPDSSLV
FT                   PYDPGNPPETIEGEKKGMVFWRFIM"
     atgaaccgca atataatcaa atgtgatggc aaaacaggac cgggccgtgc cgttcggacg        60
     gtcgtctgtc tttttgttct cctgctggtc atgtcttttt ccgctgtcgg cgcctgggcc       120
     ggtgattttg gaagaaatca ggacgctggc gacacggcgg accgtgccag acgttattct       180
     cttgattttt cagggtctgg ccagaacgac gagtgggact gggactatga ctggattaaa       240
     tttagcctgg atcagactgc ggaggtgacg tttaccctca ccaatgacag ccggtactca       300
     tatctgagag ttaccaacgg tgccaccgac ctcctcggcg actgggttgc ggcaaacacc       360
     actcaggttc tcaccctgtc gccgggtctc tattatgtgt gtgtggctgc ctatcccaac       420
     ggcattttta ccagaacacg atataccctg tccattagcg cggtgtatgg caccgcctgc       480
     tacctggacg cggacggtga cggttacggc gatccgacgg atgtgattta taacgcttcc       540
     tgccctgccg gacgggtggc caacgacgac gactgcgatg acaccgaccc ggccaaatgg       600
     tccggtgccc tggatatctg cgacggcatt gataacgact gcgacggtga tgttgatgaa       660
     gattgtgcca cctactatcg ggacacggac ggtgacgggt acggggatcc gggccatacc       720
     gccagtgccc cggccgccgg gtttgtcacg ctttccggtg actgtgatga cacgaattcg       780
     gccataaacc ccggcgccac agaggtgtgc gacggcatcg acaacaactg cgacggcgct       840
     gtcgacgata tcaatctctg gtactacctg gatgaagacg gggacggtta cggcgaccct       900
     gccggtgagt taaagccgtg cagccttacc gggtatgagg ggtatgtgga caacggcctg       960
     gattgtgatg attttgacgc cgccatccat cccggcgcca cagagatctg caacaacctg      1020
     gatgacaact gcgacggtgc tatcgacgaa gggctgccgg tggtgaccta ctattatgac      1080
     caggacggtg acgggtgggg cattcccacc aacagccagt ccggctgcac tccgccgtcc      1140
     ggtaattatg tagaggccga tgacgcggac ggtgacggca ccgatgactt tgactgcaat      1200
     gacgaaaatc cccgcattca tcccggagct tttgatccct gcaacacaac cattgatgaa      1260
     aactgcgcca atggcatgga cgactgcgaa gaatcgccag ccggctgcgc caacctggcc      1320
     gattatcccc tggaaacccg ggcgatttcg gcaaacccca tggtggagtt tctgtttgac      1380
     gactccggca gtatggcatg ggaggtgatg cataagggca cgtataatgg caagttttac      1440
     tatcagtatt attacagggg ggtgcgctcc gccagtgtgt cggatgtgtt taataccact      1500
     tcgtccacgg accggtcttt ttatcagacc cagtgtgccg atgaaaacag tctgtactac      1560
     aacccggaat acagttacgt gccctggccg ggccacactc cggccgatcc ggacagaccc      1620
     aagaagtcgc ctgacagcag cgacaccata accatgaatg ataatttttc ctccatcggc      1680
     atcagcaatg cccactattt tgtaaaggac gggggcaatg tctatctggt ggatctggat      1740
     tcctccggcg tccgatatta tacggtgagt tacgaaaccg gatcttacta ctacggtcgg      1800
     gtcaacagtg tctcgttgat agggagcgcg cccaccggtg tcaatattgg gtccctggcc      1860
     gaggcgcgcc agaactttgc aaactggttc cagttctacc ggacccggca gaacacggca      1920
     aaggcatcga tcctgcaggt ggtaaacagc ctcagcgggg taaagatcgg tgtgcacacc      1980
     attaacggca acaacagcat caccattccc aatacgggca tgctttccgt ggatgacaac      2040
     aaggccacca tccttggcta tatagaggac gtcggcgcat acagcggcac cccattgcga      2100
     ctgggactca aggcggtggg caactttttc gcgggcgact acagcggcgt tgattcgccc      2160
     tattctactg tggcggctgg cggcgagtgc caggcggcat ttgccattgt gatgaccgac      2220
     ggttactaca atggatcgaa tcccggtatc ggcaatgcgg atgccgatga tgccaacaat      2280
     gattttgacg gcccgccgtt tgccgacagt tacagcgata ccctggctga cgtggccatg      2340
     tatttttaca aaaacgacct gcgtgatgat ctggcagacg ccgtacccac caacgaatat      2400
     gaccaggcca cgcatcagca cctggtaacc tacggcgtct gcttcggcct ggtggggacc      2460
     gaagaccccg ccgactaccc caactgccct gccggcggca ccggtgcctg ccccgatccc      2520
     tggcccagcc cggggaccga tgagggaccg ggacggatcg acaatctcta ccatgccgcg      2580
     ataaacggcc ggggaaagtt tatctcggcg tccaacccat tgcagctggt agaggccatt      2640
     agagccatta tggacgatgt ggtggcgcgg agagggtccg gcgcgtcagt ggcggtgagc      2700
     acccagtcgc tgaaggaaga caccctgctt ttccaggggt cctatgattc ggccgggtgg      2760
     aagggcgacc tgcgggccta ctccatcagc atgatgaccg ggttgatcaa tccgaaccat      2820
     gtctggtcgg cggccgccgg tctggacgcg ctgaccgaca cagaggccaa ggccagaaac      2880
     atctttacat atgacggctc caccggtgtt gccttttcct atgacaacct ctccgaagac      2940
     cagcaaagca gcttgggtga aaccgagacc gatcagcggc tggtggtcga ttttattaaa      3000
     ggggaccggt caaaggagca gaataatgag aacgggctgt tcagaatccg gcgaagccgc      3060
     atgggagata ttgtccactc tgcgccggtt cacgtgggcg acacaattta cgtgggcggc      3120
     aacgacggca tgctgtatgc cttcaacgcc ctgaccggcg ccgaacggtt tgcctatatt      3180
     ccggagcatc tgtatcctta ctccaagctt tataagctgg ccgaccccaa ctacattcac      3240
     aagttctacg tggataacac gacttttgtt cgtaatgacc tgctggtctg cggactgggc      3300
     aggggggcga aggggtattt cgccctggac gtgtcaaacc cgtcgggctt tactgcttca      3360
     gacgtactgt gggagtatcc agccgtgacc tatgacggca ctgagtccga cccggacatg      3420
     ggttacacct tttcccggcc ggctgtggtg ccgtgcggag cctacggcga tgtactgata      3480
     ttcggaaacg gatacagcag caccaaccag gaggccgtac tctatgtgat tgacatcgat      3540
     gacacggacg gttcttttga ggaaagcgat gtgaaaaaga tttataccgg cgtgggcagc      3600
     acaggcacag gggtgtgcaa cggcctgtcc acccccaccc tgatcgatac cgaccaggac      3660
     ggggacctgg acatcgtcta tgccggagac ctgcagggca atctgtggaa atttgatctg      3720
     tccggcacaa aagatacatg ggcggtggcc tgcaaggatt caagcggaaa ccccaaacca      3780
     ctgtttcagg caaaagatga gagcggtaat gttcagccca tcaccaccaa gccggctgtg      3840
     accaagcact gtgccggtct tggctacatg gtggcctttg gtacgggcca gtttatggct      3900
     gagggcgatt ttgccgatat gtccactcag gccctttacg gcatatggga ctgggaaaat      3960
     gcctgggccg cggcggatga tgaactctct gccgaccagc tggacagaat gcattatggg      4020
     tacctgcggg cccccagcag cggtgttcgc ctgttctcgg agattgaggc cagcggcatg      4080
     tttgcctccc ccaatccgga ggtctcgctg acactggtga aacagagcca ggtgtctctg      4140
     tcttccagcg agcgggtcac cagtgaaaac gatgtcaact ggttttcgcc ggacaagtgg      4200
     gtggcccagc gggaagcggg agagacgcct tactccgggg gccagcatgt gggatggtac      4260
     ctggagtttc cgtccggcgg cggcgaacgg gtcatttccg acccccagat tcgaagctcc      4320
     aaaacaggca acctgctgat cttcatgtcc ctggtgccct ccatagaggt gtgccgggcc      4380
     ggcggatact ctatcttcaa cgtgctggat gcgtgtaccg ggaaatggga aaaaggcgtc      4440
     gtgctggatg atatctacta taagccgccg attattgacc cgccggaacc gccgccgccg      4500
     ttggatgacg acgatgataa tgatgatggc tatatcggtg atccggacag ttctcttgtc      4560
     ccctatgacc ccggcaaccc gccggagacc attgaagggg aaaagaaggg catggtgttc      4620
     tggcggttta tcatgtag                                                    4638
//

If you have problems or comments...

PBIL Back to PBIL home page